SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000006103 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000006103
Domain Number 1 Region: 703-975
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.02e-69
Family Protein kinases, catalytic subunit 0.00000641
Further Details:      
 
Domain Number 2 Region: 405-537
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.28e-19
Family Protein kinases, catalytic subunit 0.002
Further Details:      
 
Domain Number 3 Region: 272-374,411-435
Classification Level Classification E-value
Superfamily SH2 domain 0.0000000000000669
Family SH2 domain 0.0029
Further Details:      
 
Domain Number 4 Region: 166-259
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000467
Family Third domain of FERM 0.019
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000006103
Domain Number - Region: 22-118
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00282
Family Second domain of FERM 0.0052
Further Details:      
 
Domain Number - Region: 608-672
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00875
Family Protein kinases, catalytic subunit 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000006103   Gene: ENSMLUG00000006664   Transcript: ENSMLUT00000006685
Sequence length 987
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430755:109475:121543:-1 gene:ENSMLUG00000006664 transcript:ENSMLUT00000006685 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FYFPNWFGLETCHRFGLRKDLASAILDLPVLEYLFAQHRNDLVSGRLPVGLSLKEQGECL
SLAVLDLARMACEQAQQPEDLLKTVSYKTCLPPGLRDLIQGLSFVTRRRIRRRVRQALLR
VATCQADRHSLMAKYIMDLERLDLARATETFLVGLPGSAGGQEAKGLLRVAGGSGIAWSP
GTQEVFQPFCDFPEIVDISIKQAPRVGPAGEHRLVTITRTDNQILEAEFPGLPASLSFVA
LVDGYFRLTTDSQHYFCKEVAPPRLLEEVAQQCQGPITLDFAINKLKTGGSLPGSYVLRR
SPQDFDSFLLTVCVQTPLGPDYKGCLIRCDPTGTFSLAGLGRPHSSLRELLAACWDGGLH
VDGVALNLTFCCTPRPKEKSNLIVVRRSCSPPTSSPVQPHSGCQLSQMTFHKIAADSLEW
CENLGHGSFTKIYRGCRHETVDGEPRETEVLLKVLDAKHKHCMESFLEAASLMSQVSYQH
LVLLHGVCMAGDSIMVQEFVRLGALDTYLRKCGHLVPASWKLQVIKQLAYALNYLVSAPL
PAPSSILRGGVGGVEGGLCCMDRSLARVPGWRAKHMYGLRDDLCLYPEANGEPATGWETS
IREGGGMPISTLEPAKKLQFYEDRQQLPAPKWMELALLIQQCMAYEPGHRPSFRAVIRDL
NNLITSDYELLSDPTPGALAPHDGLWNGAQLYACQDPTIFEERHLKYISQLGKGNFGSVE
LCRYDPLGDNTGALVAVKQLQHSGPDQQRDFQREIQILKALHSDFIVKYRGVSYGPGRQS
LRLVMEYLPSGCLRDFLQRHRARLDAGRLLLYASQICKGMEYLGSRRCVHRDLAARNILV
ENETHVKIADFGLAKLLPLDKDYYVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVL
YELFTYSDKSCSPSAEFLRMMGCERDVPALCRLLDLLAEGQRLPAPPACPGEVHELMKLC
WAPSPQDRPSFSTLGPQLEALWSGSRG
Download sequence
Identical sequences G1P7K0
ENSMLUP00000006103 ENSMLUP00000006103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]