SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000006141 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000006141
Domain Number 1 Region: 497-571
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000121
Family SH3-domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000006141   Gene: ENSMLUG00000006719   Transcript: ENSMLUT00000006726
Sequence length 597
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430395:109329:114351:1 gene:ENSMLUG00000006719 transcript:ENSMLUT00000006726 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PETSELPLKSPKPEFKKLLKKFPQPEPSEHSKKPSPPEFTDLPRKPPQPEFIAVPRKPPQ
PKFTHLPKKPSKSEFSELHKKFPELEATVLPRKPLQPEVSEAPQKALQLEPSALAQKPQQ
PDLSNPIRPPTEPKLSTFPRKFWQPESNEAILTASQPEFSNFPKKPPPLEFRKPQQPQMP
PWKPEPSEPHPNFSQPDFSAFPKKTPPPQLSNLPRKALQLESGDLTRTSSEPEVCVFPKR
PQQSEFKALSKPPKPKLSSLPRTSSEPEVSLYRRKFPQSEGQGTPRKFSQPETNALPKKP
RQAEFFGDPSRKPPLPGSVSESSLPMAVAGSGPRFPLSPGFGARQKKSGVLTHGGGSRLG
LKPGHPPRQRPLPPVSSLGPPPAKPPLPPGLKDVQCFQRPSAAITTLQKTCSSAGIHFQA
RQPKAILKDQEEIYELYDDVDLTDSSPSTKGKDEVPSIQQPPRKPPQDPELRKEKAPQPQ
QLLLVDPKTLKKIRKAEKAEREFRKKFKFEGEIVIQTKMMIDPNAKTRRGGGKHLGIRRG
EILEVIEFTNKEEMLCRDTKGKYGYVPRTALLPLETEVYDDVGFLDPLESQPFPRGQ
Download sequence
Identical sequences G1P7N4
ENSMLUP00000018532 ENSMLUP00000006141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]