SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000006153 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000006153
Domain Number 1 Region: 11-39,68-73,111-247
Classification Level Classification E-value
Superfamily PH domain-like 1.05e-31
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 
Domain Number 2 Region: 350-439
Classification Level Classification E-value
Superfamily PH domain-like 2.05e-19
Family Pleckstrin-homology domain (PH domain) 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000006153   Gene: ENSMLUG00000006740   Transcript: ENSMLUT00000006739
Sequence length 696
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430704:105164:139971:1 gene:ENSMLUG00000006740 transcript:ENSMLUT00000006739 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEELIVELRLFLELLDHEYLTSTVREKKAVIADILLRIQASRGSEVRDHAPKQETPSSLP
APPQMPLPEIPQPWLPPDSGPPPLPTSSLPEGYYEEAVPLSPGKAPEYITSNYDSDAMSS
SYESYDEEEEDGKGKKTRHQWPSEEASMDLVKDAKICAFLLRKKRFGQWTKLLCVIKDTK
LLCYKSSKDQQPQMELPLPGCSIAYVPKDGKKKQHELKITQQGTDPLVLAVQSREQAEQW
LKVIREVYSGCSGPVDAECPPPPGSPVHKAELEKKLSSERPSSDGEGVVENGVAVCNGKE
QVKRKKSSKSEGKGTVSKVTGKKITKIIGLGKKKPSTDEQTSSAEEDVPTCGHLNVLSNN
RWRERWCRVKDNKLILHKDRTDLKTHLVSIPLRGCEVIPGLDSRHPLTFRLLRNGQEVAV
LEAASSEDMGRWIGVLLAETGSSTDPGALHYDYIDVEMSANIIQTAKQTFCFMNRRVIST
NPYLGGTPNGYAHPSGTALHYDDAPCVNGSWDPDGGSAASCRGGPGGEVLYDNAALYDNL
PSPKIFARYPPADRKAARPPADTLSCNHYKQPTSCGLPPAPSVTNTSSVGRASLGLGSQQ
LKSKKPPLASSGAAGKGKTLSSQPKKAEPAAGVRRTPSNADQYRYGKNRVEADARRLQTK
EEELLRRKEALRTRLAQLRKERRDLRAAIEANAGRR
Download sequence
Identical sequences G1P7P4
ENSMLUP00000006153 ENSMLUP00000006153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]