SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000006182 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000006182
Domain Number 1 Region: 162-255
Classification Level Classification E-value
Superfamily PH domain-like 5.48e-29
Family Pleckstrin-homology domain (PH domain) 0.0000049
Further Details:      
 
Domain Number 2 Region: 31-131
Classification Level Classification E-value
Superfamily SH2 domain 9.42e-27
Family SH2 domain 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000006182   Gene: ENSMLUG00000006766   Transcript: ENSMLUT00000006771
Sequence length 280
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430075:118941:166289:-1 gene:ENSMLUG00000006766 transcript:ENSMLUT00000006771 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRAESLEGKMSAQDPADLWSTSDGEAELLQDLGWYHGNLTRHAAEALLLSNGCDGSYLL
RDSNERTGLYSLSVRAKDSVKHFHVEYTGFSFKFGFNEFSSLKDFVKHFANQPLIGSETG
TLIVLKHPYPRKVEEPSIYESVRVHTAMQTGRTENDLVPTAPSLGTKEGYLTKQGGLVKT
WKTRWFTLHRNELKYFKDQMSPEPIRILDLTECSAVQFDYSQERVNCFCLVFPFRTFYLC
AKTGVEADEWIKILRWKLSQIRKQLDQREGTIRSHSFIFK
Download sequence
Identical sequences G1P7S0
ENSMLUP00000006182 XP_006100341.1.53796 XP_006773070.1.95426 XP_014321192.1.53796 XP_014321193.1.53796 XP_014321194.1.53796 XP_014321195.1.53796 XP_014321197.1.53796 XP_015425484.1.95426 XP_015425485.1.95426 ENSMLUP00000006182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]