SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000006183 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000006183
Domain Number 1 Region: 294-401
Classification Level Classification E-value
Superfamily SH2 domain 2.69e-26
Family SH2 domain 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000006183   Gene: ENSMLUG00000006772   Transcript: ENSMLUT00000006772
Sequence length 431
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430102:654311:729240:1 gene:ENSMLUG00000006772 transcript:ENSMLUT00000006772 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQQILHDMYIDPELLAELSGRSRQVEAGEMRFSPLFCWYNQSSWGAIVQSQGWRDARCE
AASDKHIQWLLGEDGEVWVWIMGEGPGDKPYEEISEELIAEKARLQAQREAEELWRQKEA
EITKKFRDALANEKARIMAEKWKVEMEDRKAAKVLEERIHEEFKRKEEEERKRGEEQIRR
QEEQRARELYWTLKQAQLQSQASEKEEREWEEQLRRSKAADEERRRRAQRARDEYRRLSL
RAIQKGTVAGLSFMLQELGQTHEQEARLYHHFPSPGPLLPLAMPVRTWERPLRPVSREII
VRWFKEEQLPRQAGFERNTKAIAPWFHGIISREDAEDLLENMTEGAFLVRVSEKIWGYTL
SYRLQKGFKHFLVDASGDFYSFLGVDPSRHATLTDLIDFHKEEIITVSGGELLQEPCGQR
DSPPDYHLLFE
Download sequence
Identical sequences G1P7S1
ENSMLUP00000006183 ENSMLUP00000006183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]