SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000006188 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000006188
Domain Number 1 Region: 5-735
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.72e-257
Family Motor proteins 0.0000000000223
Further Details:      
 
Domain Number 2 Region: 1075-1099
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000775
Family SH3-domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000006188   Gene: ENSMLUG00000006755   Transcript: ENSMLUT00000006778
Sequence length 1099
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430395:71235:94792:1 gene:ENSMLUG00000006755 transcript:ENSMLUT00000006778 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSKERFHWQSHNVKQSGVDDMVLLPQITEDAIVGNLRKRFMDDYIFTYIGSVLISVNPFK
QMPYFTDREIDLYQGAAQYENPPHIYALTDNMYRNMLIDCENQCVIISGESGAGKTVAAK
YIMGYISKVSGGGEKVQHVKDIILQSNPLLEAFGNAKTVRNNNSSRFGKYFEIQFSRGGE
PDGGKISNFLLEKSRVVTQNENERNFHIYYQLLEGASQEQRQNLGLMTPDYYYYLNQSDT
YKVDGTDDRSDFSETVSAMQVIGIPPNVQQLVLQLVAGILHLGNISFCEDGNYARVESVD
LLAFPAYLLGIDSGRLQEKLTSRKMDSRWGGRSESIDVTLNVEQAAYTRDALAKGLYSRL
FDFLVEAINRAMQKPQEEYSIGVLDIYGFEIFQKNGFEQFCINFVNEKLQQIFIELTLKA
EQEEYVQEGIRWTPIQYFNNKIVCDLIENKLSPPGIMSVLDDVCATMHATGGGADQTLQQ
KLQVAVGTHEHFNSWSAGFVIHHYAGKVSYNVSGFCERNRDVLFSDLIELMQTSEHAFLR
MLFPEKLDVDKKGRPSTAGSKIKKQANDLVATLKKCTPHYIRCIKPNETKRPHDWEESRV
KHQVEYLGLKENIRVRRAGFAYRRQFAKFLQRYAILTPQTWPRWRGDERQGVQHLLRAVN
MEQDQYQMGSTKVFVKNPESLFLLEEMRERKFDGFARTIQKAWRSHVAIRKYEEMREEAS
NILLNKKERRRNSINRNFVGDYLGLEERPELRQFLGKRERVDFADSVTKYDRRFKPIKRD
LILTPRCVYMIGREKVKKGPEKGQVREVLKKKLEIQALRGVSLSTRQDDFFILQEEAADS
FLESIFKTEFVSLLCKRFEEAARRPLPLTFSDTLQFRVKKEGWGGGGTRSVTFSRGSGDV
AALKASGRALTVSVGDGLPKSSKPTRKGAAQGRPRRSAPGPSRAAPGRPRGLDRNGVPPS
ARGGPLPLEITSGGGSQRPPQGPPPSGQRASRRPRARPPSEHNTEFLNVPDEGVAGMQRK
HRIGQRPVPGVGRHKAPSHRTLFLRAGHCYQECGPNIETMGRGLREEYNLCLMPDSSGWW
KGRLHGQEGLFPGNYVEKI
Download sequence
Identical sequences G1P7S5
ENSMLUP00000006188 ENSMLUP00000006188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]