SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000006205 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000006205
Domain Number 1 Region: 319-571
Classification Level Classification E-value
Superfamily p53-like transcription factors 4.31e-86
Family STAT DNA-binding domain 0.000000676
Further Details:      
 
Domain Number 2 Region: 139-318
Classification Level Classification E-value
Superfamily STAT 9.81e-43
Family STAT 0.00012
Further Details:      
 
Domain Number 3 Region: 572-689
Classification Level Classification E-value
Superfamily SH2 domain 2.42e-38
Family SH2 domain 0.0000294
Further Details:      
 
Domain Number 4 Region: 1-124
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 1.26e-29
Family Transcription factor STAT-4 N-domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000006205   Gene: ENSMLUG00000006785   Transcript: ENSMLUT00000006796
Sequence length 854
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429886:3162377:3173609:1 gene:ENSMLUG00000006785 transcript:ENSMLUT00000006796 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQWEMLQNLDSRFQDQLHQLYTNSLLPVDIRQYMAVWIEDQNWQEAALGNDNSQANMLC
FHFVDQLNYERARCSQDPECLLLQHNLRKFCQDIQALPRGPIQLAEMIFNLLLEEKRILM
QAQRAQVEQEEPALEAPVQSQHHAIESRILELKAMMEKLVKSISHLKDLQDVFLFRYKTQ
APVRTSSLDPHQTRQQQILQATLNELDRRRKEVLDASRGLLGRLTTLIELLLPNLEQWKV
QQQKTCIGAPPDGGLELLQLEKWFTDGAKLMFHLRQLLKELKDLSQLVSYENDPLITGVG
QQEAQVTELLQHLLHRAFVVETQPCMPQTPHRPLILRTGSKFTVRTRLLVRLQEGSESLT
AEVFIDKNPPQSQGTSFRKFNILTSTQKTLTPEKGQSQGLIWDFGYLTLLEQRSSGSGKG
SNKGLLGVTEELHIISFTVRYTYQGLKQELKADTLPVVIISNMNQLSIAWASILWFNLLS
SNPQNQQFFSSPPKAPWTLLGPALSWQFSSYVGRGLDQDQLSMLKDKLFGQNSGNEGALL
SWADFTKRESPPGKLPFWTWLDKILDLVHEHLKDLWNDGRIMGFVSRSQERRLLKKTVSG
TFLLRFSETSEGGITCSWVEHQDDDKVLIHSVKPFTKEVLQSLPLTKIIRHYQLLTEENI
PENPLRFLYPRTPRDEAFGCYYEDKVNLEEQRKYLTRKLIVVSNRQVDELQQPLEPNLEP
EVEPLDLPPVLAPGPELGLDLELEPLLKAGLDLGPPLEPELELEPTLDLGPELKLEPLLE
PVSQPVPEPEPEPDLPHDLRHLNTEEMEIFRNNMKIEEIMPNGDPLLAGQNTVDEAYNFH
PSHFFMDGPLTPDY
Download sequence
Identical sequences G1P7U2
ENSMLUP00000006205 ENSMLUP00000006205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]