SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000006241 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000006241
Domain Number 1 Region: 23-110
Classification Level Classification E-value
Superfamily UBA-like 4.5e-31
Family UBA domain 0.0000966
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000006241   Gene: ENSMLUG00000006809   Transcript: ENSMLUT00000006834
Sequence length 1129
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430013:980019:1050015:1 gene:ENSMLUG00000006809 transcript:ENSMLUT00000006834 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMTSVSSDRSRGAREKTQISATQATQLQKQVVQATAEQMRLAQVIFDKNDSEFEAKVKQL
MEVTGKNQDECIVALHDCNGDVNKAINILLEGNSDTTSWETVGGKKKNFGKESSENKENR
EKRSEREVSRGRGNNNRKGRGGNRGREFRGEENGIDCNQGDKPSDRGKRARGRGFGRGRG
RGAGRFSTQGMGTFNPADYSDSPSIDGCGTKPVVWEAAQNGADEGSELASDAQNVAQDLP
NKNSYGHKGAWKNSVEEWTTEDWTEDLSETKVFTASSVPQENHVTPGKSVDLVALLQKPV
PPNQASEVSSFETSQQQGFGQALVFTNSQHSNQMAPGTGSSTAVNSYSPQSLSSVLGSGF
GELAPSKMANTTSSQILDQLKPPSLGQFTTTPSSQQNSTSAPTTTSSWDLKPSATQSSVR
SHFDFKSQPEPSPVLSQLTQRQQHQTQAVTVPPPGLESFPSQVKLRESAPRDSTSTVNKL
LQLPSLTVENISVTAHQPQPKHIKLPKRRIPPASKIPASAVEMPGSADVTGLNVQFGALE
FGSESSLSEFGSAASSENSNQIPISLYSKSLSDSLNTSLPMTSAVQNSTYTTSVITSSSL
TSSSLSSTSPATTSSSYDQSSVHNRVAYQSSVSPSESVPGTVTNGHGGGRSQQTVDTPKT
TDPPSALPSVASLPSTTSCSTLLPSASQHTATLPSLSQPGDLSSTPLSQLSSSLSTHQSS
LSSAHTALSSSTSHTHTSVENTPSLQSSATFSMAATSASSATSSGLSLPSSMNTVNSLCL
GGTTVSAPSSSTRATPLVTSGKAPPNLPQGVPPLLHNQYLVGPGGLLPAYPIYGYDELQM
LQSRLPVDYYGIPFATPTALASRDGSLANNPYSGDITKFGRGDSASPAPPTTLAQAQQSQ
SQAHHTPQQPFLNPALPPGYSYTGLPYYTGVPSAFQYGPTMFVPPASAKQHGVNLSTPPT
PFQQASGYGPHSYSTGYDDLTQGTAAGDYTKGGYGGSSQAQNKSAGSGPGKGVSVSSSTT
GLPDMTGSVYNKTQTFDKQGFHAGTPPPFSLPSALGSTGPLAPGAAPGYAPPPFLHILPA
HQQPHSQLLHHHLPQDAQSGSGQRSQPSSLQPKSQASKPAYGNSPYWTN
Download sequence
Identical sequences G1P7X5
ENSMLUP00000006241 ENSMLUP00000006241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]