SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000006244 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000006244
Domain Number 1 Region: 66-249
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.68e-76
Family F-box associated region, FBA 0.00000143
Further Details:      
 
Domain Number 2 Region: 4-83
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000000693
Family F-box domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000006244   Gene: ENSMLUG00000006843   Transcript: ENSMLUT00000006837
Sequence length 298
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430268:469176:474946:1 gene:ENSMLUG00000006843 transcript:ENSMLUT00000006837 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLSINELPENILLEVFIYVPARQLVLDCRPVCSLWRYLIDLMTLWKRKSLREGLISKDYD
EPVSDWKIFYFLCILRRNLLRNPCAEEGMRSWKIDRNGGNHWKVESLPGGHGQGFPDSKV
KKYFVTSYELCLKSQMVDLKAEGYWEELMDTIRPDIVVKDWFAARADCGCTYSIRVQLVS
ANYIVLASFEPPPVTIEQWSDAQWREVSHTFSDYPPGVRHILFQHGGKDTQYWAGWYGPR
VTNSSITISPKTTRSPAASTTQPETMQELGKCRILGSSTRQATHAGQSWAGNWHRLTR
Download sequence
Identical sequences G1P7X8
ENSMLUP00000006244 ENSMLUP00000006244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]