SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000006288 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000006288
Domain Number 1 Region: 149-255
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.000000864
Family cAMP-binding domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000006288   Gene: ENSMLUG00000006888   Transcript: ENSMLUT00000006883
Sequence length 360
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430107:944606:972419:-1 gene:ENSMLUG00000006888 transcript:ENSMLUT00000006883 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNYTESSPLAESPAIGFTSKLESIIPVPSNETTCENWREIHHLVFHVANVFFAIGLVIPT
TLHLHMILLRGMLAIGCSFYIMWATLYRCALDIVIWNSVFLGVNMLHLSYLLFKKRPVKI
EKELNGVYRRLFEPLLVPPDLFRRLTGQFCMIQTLTKGQTYAAEDKTSVDDRLSILLKGR
MKVSYRGHFLHNIYPCAFIDSPEFRSTQMHKGEKFQVTIVADDNCRFLCWSRERLTYFLE
SEPFLYEIFRYLIGKDITNKLYSLNDPTLNDKKAKKLEHQLSLCTQISMLEMRNSIASSS
DSEDGLHQFLRGTPSVSSLHVSSPHQRASAKMKPIEEGVEDDDEVFEPVSPKTFKVHELP
Download sequence
Identical sequences G1P814 S7NPI6
ENSMLUP00000006288 ENSMLUP00000006288 XP_005883859.1.60319 XP_006101142.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]