SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000006303 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000006303
Domain Number 1 Region: 74-407
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.62e-80
Family Protein kinases, catalytic subunit 0.00000218
Further Details:      
 
Domain Number 2 Region: 1008-1066
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000000124
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0025
Further Details:      
 
Domain Number 3 Region: 1082-1203
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000188
Family Pleckstrin-homology domain (PH domain) 0.035
Further Details:      
 
Domain Number 4 Region: 1234-1486
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 0.0000012
Family Tricorn protease domain 2 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000006303   Gene: ENSMLUG00000006863   Transcript: ENSMLUT00000006899
Sequence length 1636
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430277:251035:426989:1 gene:ENSMLUG00000006863 transcript:ENSMLUT00000006899 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGEVRLRQLEQFILDGPARTHGQCFSVETLLDILICLYDECNNSPLRREKNILEYLEWA
KPFTSKVKQMRLHREDFEILKVIGRGAFGEVAVVKLKNADKVFAMKILNKWEMLKRAETA
CFREERDVLVNGDNKWITTLHYAFQDDNNLYLVMDYYVGGDLLTLLSKFEDRLPEDMARF
YLAEMVIAIDSVHQLHYVHRDIKPDNILMDMNGHIRLADFGSCLKLMEDGTVQSSVAVGT
PDYISPEILQAMEDGKGRYGPECDWWSLGVCMYEMLYGETPFYAESLVETYGKIMNHKER
FQFPPQLTDVSENAKDLIRRLICSREHRLGQNGIEDFKKHPFFSGIDWENIQNCEAPYIP
EVSSPTDTSNFDVDDDCLKNSETMPPPTHTAFSGHHLPFVGFTYTSSCVLSDRSCLRVTA
APTSLDLDANVQRTLDNNLATEAYERRIKRLEQEKLELSRKLQESTQTVQALQYSTVDGP
LTASKDLEIKSLKEEIEKLRKQVRESSQLEQQLEEANSVRRELDDAFRQIKANEKQIKTL
QQEREELNKELVQASERLKNQSKELKDAHCQRKLAMQEFMEINERLTELHTQKQKLARHV
RDKEEEVDLVMQKVESLRQELRRTERAKKELEVHTEAVAAEASKDRKLREQSEHYSKQLE
NELEGLKQKQISYSPGGYSIEHQQEITKLKTDLEKKSIFYEEELSKREGIHANEIKNLKK
ELHDSEGHQLALNKEIMILKDKLEKNRRESQSEREEFENEFKQQYEREKVLLTEENKKLT
SELDKLTALYENVSVRNRQLEEEVKDLADKKESVAHWEAQITEIIQWVSDEKDARGYLQA
LASKMTEELEALRNSSLGTRATDMPWKMRRFAKLDMSARLELQSALDAEIRAKQAIQEEL
NKVKASNIITECKLKDAEKKNLELLSEIEQLIKDTEELRSEKGVEHRDSQHSFLAFLNTP
TDALDQFERSPSCTPASKGRRTVDSSPLPVHTPTLKKKACPGSTGFPSKRKTHQFFVKSF
TTPTKCHQCTSLMVGLIRQGCSCEVCGFSCHITCVNKAPTACPVPPEQTKGPLGIDPQKG
IGTAYEGHVRIPKPAGVKKGWQRALAVVCDFKLFLYDVAEGKASQPSVVVSQVIDMRDEE
FSVSSVLASDVIHASRKDIPCIFRVTMSQLSAPNNKCSILMLADSENEKSKWVGVLSELQ
KILKKNKFRDRSVYVPKEAYDSTLPLIKTTQAAAIIDHERIALGNEEGLFVVHVTKDEII
RVGDNKKIHQIELIPNDQLVAVISGRNRHVRLFPMSALDGRETEFYKLAETKGCQTITSG
KLRHGTLTCLCVAMKRQVLCYELFQSKTRHRKFKEIQVPYNVQWMAVFSEHLCVGFQSGF
QRYPLNGEGTSCSMLHSSDHTLAFVTHQPMDAICAVEISSKEYLLCFSSIGVYTDCQGRR
SRQQELTWPANPSSCCYNAPYLSVYSENAVDVFDVNSMEWIQTLPLKKVRPLNSEGSLNL
LGLETIRLIYFKNKMAEGDELVVPETTDNSRKQMVRNINNKRRYSFRVPEEERMQQRREM
LRDPEMRNKLISNPTNFNHIAHMGPGDGIQILKDLPMNPRPQESRTVFSGSVSIPSITKS
RPEPGRSMSASSGLSA
Download sequence
Identical sequences G1P829
ENSMLUP00000006303 ENSMLUP00000006303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]