SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000006337 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000006337
Domain Number 1 Region: 30-159
Classification Level Classification E-value
Superfamily PH domain-like 4.98e-27
Family Pleckstrin-homology domain (PH domain) 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000006337   Gene: ENSMLUG00000006923   Transcript: ENSMLUT00000006933
Sequence length 1169
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430798:43483:81644:-1 gene:ENSMLUG00000006923 transcript:ENSMLUT00000006933 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNKAGGKRPATTNSDISNHNMVSEVPPERPSVRVSPASSWGVRYNKAHFLRERANARMW
EKGGIHVAASSGVKQWNKRWFVLVDRCLFYYKDEKEESILGSIPLLSFRVAAVQPAPGDG
RGVQTTFPAEHAGVRTYFFSAESPEEQEAWIQAMGEAARVQIPPAQKSVPQAVRLNHEKP
DSENTPPSQHHHQPPHNSFPNPEPEAKTRGEGDGRGCEKAERRPERPDIQSEPLVKANGI
QAGPEPASEPGSPYPGAPRVPGGGERPPQPNGWQYGSPSRPGSTAFPPQDSESGGRRPSF
PPHANPDKIAQRKSSMSQLQQWVNLRRGVPPPETFGANPSRFYPMSRRGPEYCGPYSSPF
PDDYQYYPPGVRPDSICSMPAYDRISPPWALEDKRHSFRNGCGWKEPASYGRQDGTVWIP
SPSRQPVYYDELDAASGSLRRLSLQPRSHSVPRSPSQGSYSRTRIYSPVRSPSARFERLP
PRSEDIYVDPTAYVMRRSISSPKYDYLGDRRPVPAGLYPYNYPPPPTVHDKMDSKMGAIL
SLNRPFLPLLQMSESETLISMVNRMVESSSPRAQLFMQVPPYPEVFRDSAHTYKLNEQDT
DKLLGKLCEQNKVVREQDRLVQQLRAEKESLESALMGTHQELEMFGSQPAYPEKLLHKKE
SLQNQLINIRVELSQATTALTNSTTEYESLESEVSALHDDLWEQLNLDIQNEVLNRQIQK
EIWRIQDVMEGLRKNNPSRGTDTAKHRGGLGPSTTYSSNSPASPLSSASLTSPLSPFSLV
SGSQGSPTKSGSNEEPGPPRPPLPKAYVPLESPPTVPPLPSESHFWPYPNSPSWHCSGET
ARGQPKASYDPSKRESHQTSPPDTSRDISLVPARQEVEADKQTALNKVGIVPPRTKSPAE
EEMTPSGVVRRNANGLPNGLSGRQERPKSAVFPGEGKVKMSVEEQIDRMRRHQSGSMKEK
RRSLQLPASPAPDPSPRPAYKVVRRHRSIHEVDISNLEAALRAEEPGGQAYETPREEIAR
LRKMELEPQHYDVDINKELSTPDKVLIPERYIDLEPDTPLSPEELKEKQKKVERIKTLIA
KSSMQNVVPAGEGDLVDVPQDSESQLQEQEKRIEISCALATEASRRGRMLSVQCATPSPP
TSPASPTSPANPLSSESPRGTDSSHAMRV
Download sequence
Identical sequences G1P856
ENSMLUP00000006337 ENSMLUP00000006337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]