SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000006358 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000006358
Domain Number 1 Region: 1-266
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 7.95e-76
Family FCH domain 0.000000000321
Further Details:      
 
Domain Number 2 Region: 310-334,532-589
Classification Level Classification E-value
Superfamily SH3-domain 6.71e-16
Family SH3-domain 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000006358
Domain Number - Region: 384-455
Classification Level Classification E-value
Superfamily HR1 repeat 0.0209
Family HR1 repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000006358   Gene: ENSMLUG00000006949   Transcript: ENSMLUT00000006955
Sequence length 597
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430372:179238:235934:-1 gene:ENSMLUG00000006949 transcript:ENSMLUT00000006955 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IDILEKYLIFVKERTEIELSYAKPLRNLSKKYQPKKNSKEEEEYRYTACKAFLSTLNEMN
DYAGQHEVVSENLTSQILAGLARYVQELKQERKSHFHDGRKAQQHIETCWKQLESSKRRF
ERDCKEADRAQQYFEKMDADINVTKADVEKARQQAQVRHQMAEDSKADYSSILQKFNHEQ
REYYHTHIPNIFQKIQEMEERRIVRLGESMKTYAEVDRQVIPIIGKCLDGIVKAAECIDE
KTDSQLVIEAYKSGFEPPGDIEFEDYTQPMKRTVSENSLSNSRGEGKAELKFGGKPKGKL
WPFIKKNKLMSLLTSPHQPPPPPPASASPSAVPNGPQSPKQQKEPLSHRFNEFMTSKPKI
HCFRSLKRGLSLKLGAAPEDFSNLPPEQRRKKLQQKVDELNKEIQKEMDQREAITKMKDV
YLKNPQMGDPASLDHKLTEVIQNIDKLRLEAQKFEAWLAEVEGRLPARGEQRRQSGLYDA
QPAPAVNNCAQARESRNGQLHGGAEARRSGGERCWATDFDDEFDDEEPLPAIGTCKALYT
FDGQNEGTISVVEGETLYVIEEDKGDGWTRIRRNEDEEGYVPTSYVEVYLDKNAKGA
Download sequence
Identical sequences G1P874
ENSMLUP00000006358 ENSMLUP00000006358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]