SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000006397 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000006397
Domain Number 1 Region: 997-1346
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.24e-83
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.000000577
Further Details:      
 
Domain Number 2 Region: 818-994
Classification Level Classification E-value
Superfamily ARM repeat 4.41e-55
Family Phoshoinositide 3-kinase (PI3K) helical domain 0.00025
Further Details:      
 
Domain Number 3 Region: 650-797
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.74e-33
Family PLC-like (P variant) 0.0078
Further Details:      
 
Domain Number 4 Region: 328-485
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.08e-32
Family Ras-binding domain, RBD 0.0092
Further Details:      
 
Domain Number 5 Region: 1375-1496
Classification Level Classification E-value
Superfamily PX domain 8.76e-27
Family PX domain 0.0015
Further Details:      
 
Domain Number 6 Region: 1513-1640
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 8.78e-27
Family Synaptotagmin-like (S variant) 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000006397   Gene: ENSMLUG00000006948   Transcript: ENSMLUT00000006998
Sequence length 1644
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429912:85328:131084:-1 gene:ENSMLUG00000006948 transcript:ENSMLUT00000006998 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EALLVSSVPILTMSSTPGNGKHWESLESVGISRKELAMAEALQMEYDALSRLRHDKEENR
TKQNTDPSLIDWEEPALDFYNKPAGRQKDLKLLRGLSGSDPTLNYNSLSPQEGLPNHSTS
QGSQPGPDPWPKGSLAGDYLYIFDGSDGGLSLSPRPGDTDGSSKKLSPPPLPPRVSIWDT
PPLPPRKRAPSSSKISQPNDINTFSLVEQPPGKLLGHQILEDAEPRSGGTGRRLGPVDYD
GINDAITRLNLKSTYDAEMVRDATRGWKEGRGPLDFGKDIPGKPVARSKTMPPQVPPRTY
VSRCANRKNATPGKNHRISAASVVSRPHAVANGHELFEVSEERDEEVAAFCHMLDVLRSG
SDVQDYFLTGYVWSAVSPSPEHLGDEVNLKVTVLCDSLQEPLTFTCNCSSTVDLLIYQTL
CYTRDELRGVDVGDFVLKPCGLEEFLQNKQALGSHEYIQHCRKFDIDIRLQLMEQKSIRS
DLARTVNDDQSPSTLNYLVHLQERPVKQTISRQALSLLFDTYHNEADAFLLADGDFPLKA
DRVVQSVKAICNALAAVETPEITSALNQLPPCPSRLQPKIQKDPTVLAARENREKVMEAL
TAAILDLVELYCNTFNADFQTAVHGSHRHDLVQEACHFSGPLAFTVYATHRIPITWAASY
EDFYLSCSLSHGGKELCSPLQTRKAHFSKYLFHLIIWDQRICFPVQVNRLPRETLLCATL
YALPTPPPGSSSEAGKQRRVPEALGWVTTPLFNFRHVLTCGRKLLGLWPATQENSSARWS
TPNFHQPDSVILQIDFPTSAFDIKFTSPSGDKFSPCYEFGSLREEDQRALKNIMQKECLY
WLADADKKRLWEKRYYCHSEVSSLPLVLASAPSWEWACLPDIYALLKQWTHMNHQDALGL
LHATFPDQEVRRMAVQWIGSLSDAELLDYLPQLVQALKYECYLDSPLVRFLLKRAVSDLR
VTHYFFWLLKDGLKDSQFSIRYQYLLAALLCCCGKGLREEFNRQCWLVNTLAKLAQQVRE
ATPSARQGILRTGLEEVKQFFALNGSCRLPLSPSLLVKGIVPRDCSYFNSNAIVSFQNGD
ALAETVRVFITCGDDLRQDMLTLQMIRIMNKIWVQEGLDMRMVIFRCFSTGRGKGMVEVI
PNAETLRKIQVEHGVTGSFKDRPLADWLQKHNPGEVEYEKAVENFIYSCAGCCVATYVLG
ICDRHNDNIMLKTTGHMFHIDFGRFLGHAQMFGNIKRDRAPFVFTSDMAYVINGGDKPSS
RFHDFVDLCCQAYNFIRKHTHLFLNLLGLMLSCGIPELSDLEDLKYVYDALRPQDTEANA
TTYFTSNRLIESSLGSVATKLNFFIHNLAQMKFTGSDDQLTLSFAPRTHTLQRSGRLSDV
FLCRQEKVFHPNKTYIYVVKVMRENSHEATYIQRTFEEFQELHNKLRLLFPSSLLPSFPS
RFLIGRPRGEAGAERRREELNGYIWHLIRATPEVAECDLVYTFFHPLPRDEKAAGTSLAP
KSSEGSWAQPVEKVGGEVKLSISYKNNKLFIMVMHIRGLQVLQDGNDPDPYVKIYLLPDP
QKTTKKKTKVARKTCNPTYNEMLVYDGIPKGDLQQRELQLSVLSEQGFWENVLLGEVHIR
LRELDLAQEKTGWFALGSRSHEAS
Download sequence
Identical sequences G1P8A6
ENSMLUP00000006397 ENSMLUP00000006397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]