SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000006407 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000006407
Domain Number 1 Region: 287-459,514-675
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 1.18e-130
Family Mammalian PLC 0.00000000339
Further Details:      
 
Domain Number 2 Region: 907-1159
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 2.88e-58
Family C-terminal domain of PLC-beta 0.00031
Further Details:      
 
Domain Number 3 Region: 116-283
Classification Level Classification E-value
Superfamily EF-hand 4.08e-48
Family EF-hand modules in multidomain proteins 0.0000118
Further Details:      
 
Domain Number 4 Region: 4-114
Classification Level Classification E-value
Superfamily PH domain-like 4.79e-35
Family Pleckstrin-homology domain (PH domain) 0.0000789
Further Details:      
 
Domain Number 5 Region: 696-809
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.53e-23
Family PLC-like (P variant) 0.0000319
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000006407   Gene: ENSMLUG00000006981   Transcript: ENSMLUT00000007011
Sequence length 1198
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430612:55685:67722:-1 gene:ENSMLUG00000006981 transcript:ENSMLUT00000007011 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QEASSRNLVTLRVDSNGFFLYWTGPNMEVDTLDISSIRDTRTGRYARLPKDPKIREVLGF
GGPDARLEEKLMTVVAGPDPVNTTFLNFMAVQDDTAKVWAEELFKLAMNILAQNASRNTF
LRKAYTKLKLQVNQDGRIPVKNILKMFSADKKRVETALESCGLNFNRSESIRPDEFSLEI
FERFLNKKLCLRPDIDKILLEIGAKGKPYLTLEQLMDFINQKQRDPRLNEVLYPPLGPSQ
TRLLIEKYEPNKQFLERDQMSMEGFSRYLGGEENGILPLEALDLSADMTQPLSAYFINSS
HNTYLTAGQLAGTSSVEMYRQALLWGCRCVELDVWKGRPPEEEPFITHGFTMTTEVPLRD
VLEAIAETAFKTSPYPVILSFENHVDSAKQQAKMAEYCRSIFGDALLIDPLDKYPLAPGV
PLPSPQDLMGRILVKNKKRHRPSTGVPNSSVRKRPLEQSNSALSESSAATEPSSPQLGSP
SSDSCPGLSNGEEAGLEKLSLEPRKSLTEEGPQRGPDLGPADREEEEEDEEEEEQPDPKK
PTTDEGTASSEVNATEEMSTLVNYIEPVKFKSFEAARKRNKCFEMSSFVETKAMEQLTKS
PMEFVEYNKQQLSRIYPKGTRVDSSNYMPQLFWNVGCQLVALNFQTLDVAMQLNAGVFEY
NGRSGYLLKPEFMRRPDKSFDPFTEVIVDGIVANALRVKVISGQFLSDRKVSIYVEVDMF
GLPVDTRRKYRTRTSQGNSFNPVWDEEPFDFPKVVLPTLASLRIAAFEEGGKFVGHRILP
VSAIRSGYHYICLRNEANQPLCLPALLIYTEASDYIPDDHQDYAEALINPIKHVSLMDQR
AKQLAALIGEREAQAGPETSQETQSPQQGSQLTPNPTPSPLDTSPRRPPGPTTSPTSPSL
SSPGQRDDLIASILSEVAVAPLEELRGHKALVKLRSRQERDLRELHKKHQRKAFALTRRL
LDSLAQARAESRCRPRPGVLVGEDKKEEEEEVRRYQEFQKRQVQSLLELREAQADAEAER
RLEHLRQALQRLREIVLDAHTTQVKRLKEMNDREKKELQKILDRKRHNSISEAKTREKHK
KEAELTEINRRHITESVNSIRRLEEAQKQRHERLVAGQQQVLQQLLEEEPKLLAQLAQEC
QEHRARLPQEIRRCLLGEKSEGLGDGHLVASASNGHAPGSSGHLSGAELESQEENTKL
Download sequence
Identical sequences G1P8B5
ENSMLUP00000006407 ENSMLUP00000006407

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]