SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000006410 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000006410
Domain Number 1 Region: 22-295
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.49e-47
Family Ankyrin repeat 0.00024
Further Details:      
 
Domain Number 2 Region: 373-421
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000017
Family SOCS box-like 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000006410   Gene: ENSMLUG00000007018   Transcript: ENSMLUT00000007014
Sequence length 426
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429782:4009174:4066282:1 gene:ENSMLUG00000007018 transcript:ENSMLUT00000007014 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGTALPVSTPAAAKLVKRNFLEALKSNDFGKLKAILIQRQIDVDTVFEVEDQNMVLASY
KQGYWLPSYKLKSSWATGLHLSVLFGHVECLLVLLDHNATINCRPNGKTPLHVACEMANL
DCVKILCDHGAKLNSYSLSGHTALHFCTTPSSILCAKQLVWRGANVNMKTNNQDEETPLH
TAAHFGLSELVAFYVEHGAVVDSVNAHMETPLAVATYWALRFKEQEYSREHHLVCRMLLD
YHAEVNARDDDFKSPLHKAAWNCDHVLMHMMLEAGAEANLMDINGCAAIQYVLKVTSVRP
AAQPEICYQLLLNHGAARIYPPQFHKVIQACHSCPKAIEVVVNAYEHIKWNVKWKRAIPD
DDLERHWDFYHSLFTVCSNSPRTLMHLSRCAIRRTLHNRCHRVIPLLSLPLSLKKYLLLE
PEGIIY
Download sequence
Identical sequences G1P8B7
ENSMLUP00000006410 ENSMLUP00000006410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]