SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000006434 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000006434
Domain Number 1 Region: 134-379
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.23e-37
Family Voltage-gated potassium channels 0.0076
Further Details:      
 
Domain Number 2 Region: 380-556
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.32e-36
Family cAMP-binding domain 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000006434   Gene: ENSMLUG00000007044   Transcript: ENSMLUT00000007041
Sequence length 647
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429807:2570662:2575771:-1 gene:ENSMLUG00000007044 transcript:ENSMLUT00000007041 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEKSNGIKSSPANNHNHHAPTAIKANGKDDHRKSSRPESAAEDDTSSELQRLAAMDAPQ
RGRGGFRRIVRLVGVIREWANKNFREEEPRPDSFLERFRGPELQTVTTQQGDGKGDKDGE
GKGTKKKCEIFVIDPAGDWYYRWLFVVAMPVLYNWCLLVARACFSDLQKNYYLVWLVLDY
YSDVVYIADLFVRLRTGFLEQGLLVKDTKKLRDNYIHTLQFKLDMASIIPTDLVYFAVGI
HNPELRFNRLLHFARMFEFFDRTETRTSYPNIFRISNLVLYILVIIHWNACIYYAISKSI
GFGVDTWVYPNITDPEYGYLAREYIYCLYWSTLTLTTIGETPPPVKDEEYLFVIFDFLIG
VLIFATIVGNVGSMISNMNATRAEFQAKIDAVKHYMQFRKVSKEMEAKVIKWFDYLWTNK
KTVDEREVLKNLPAKLRAEIAINVHLSTLKKVRIFQDCEAGLLVELVLKLRPQEMYIIKE
GKLAVVADDGVTQYALLSAGSCFGEISILNIKGSKMGNRRTANIRSLGYSDLFCLSKDDL
MEAVTEYPDAKKVLEERGREILMKEGLLDENEVATNMEVNVQEKLEQLETNMETLYTRFG
RLLAEYTGAQQKLKQRITVLETKMKQNEDDYLSDGANSPEPAVAEKP
Download sequence
Identical sequences G1P8D9
ENSMLUP00000006434 ENSMLUP00000006434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]