SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000006437 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000006437
Domain Number 1 Region: 40-179
Classification Level Classification E-value
Superfamily PX domain 0.00000000000118
Family PX domain 0.01
Further Details:      
 
Domain Number 2 Region: 214-411
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000000126
Family BAR domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000006437   Gene: ENSMLUG00000007049   Transcript: ENSMLUT00000007045
Sequence length 415
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429789:4850764:4903983:1 gene:ENSMLUG00000007049 transcript:ENSMLUT00000007045 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CAGSRLGAAMMEGLDDGPDFLSEEDRGLKAINVDLQSDAALQVDISDALSERDKVKFTVH
TKSSLPNFKQNEFSVVRQHEEFIWLHDSFVENEDYAGYIIPPAPPRPDFDASREKLQKLG
EGEGSMTKEEFTKMKQELEAEYLAIFKKTVAMHEVFLCRVAAHPILRKDLNFHVFLEYNQ
DLSVRGKNKKEKLEDFFKNMVKSADGVIVSGVKDVDDFFEHERTFLLEYHNRVKDASAKS
DRMTRSHKSAADDYNRIGSSLYALGTQDSTDICKFFLKVSELFDKTRKIEARVSADEDLK
LSDLLKYYLRESQAAKDLLYRRSRSLVDYENANKALDKARAKNKDVLQAETSQQLCCQKF
EKISESAKQELIDFKTRRVAAFRKNLVELAELELKHAKGNLQLLQNCLAVLNGDT
Download sequence
Identical sequences G1P8E2
ENSMLUP00000006437 ENSMLUP00000006437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]