SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000006464 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000006464
Domain Number 1 Region: 268-579
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.66e-93
Family Protein kinases, catalytic subunit 0.0000000102
Further Details:      
 
Domain Number 2 Region: 99-158
Classification Level Classification E-value
Superfamily Cysteine-rich domain 2.54e-21
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00038
Further Details:      
 
Domain Number 3 Region: 11-84
Classification Level Classification E-value
Superfamily Cysteine-rich domain 3.89e-20
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000006464   Gene: ENSMLUG00000007061   Transcript: ENSMLUT00000007078
Sequence length 600
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429773:13168146:13320068:-1 gene:ENSMLUG00000007061 transcript:ENSMLUT00000007078 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APKDNEERVFRERMRPRKRQGAVRRRVHQVNGHKFMATYLRQPTYCSHCRDFIWGVIGKQ
GYQCQVCTCVVHKRCHELIITKCAGLKKQETPDEVGSQRFSVNMPHKFSIHNYKVPTFCD
HCGSLLWGLLRQGLQCKVCKMNVHRRCETNVAPNCGVDARGIAKVLADLGVTPDKITNSG
QRRKKLLAGAESPQPASGGSPSEEDRSKSAPTSPCDQELKELENNIRKALSFDNRGEEHR
AAGSTDGQLASPGENGEVRQGQTKRLGLDEFNFIKVLGKGSFGKVMLAELKGKDEVYAVK
VLKKDVILQDDDVDCTMTEKRILALARKHPYLTQLYCCFQTKDRLFFVMEYVNGGDLMFQ
IQRSRKFDEPRSRFYAAEVTSALMFLHQHGVIYRDLKLDNILLDAEGHCKLADFGMCKEG
ILNGVTTTTFCGTPDYIAPEILQELEYGPSVDWWALGVLMYEMMAGQPPFEADNEDDLFE
SILHDDVLYPVWLSKEAVSILKAFMTKNPHKRLGCVAAQNGEDAIKQHPFFKEIDWVLLE
QKKIKPPFKPRIKTKRDVNNFDQDFTREEPVLTLVDEAIVKQINQEEFKGFSYFGEDLMP
Download sequence
Identical sequences G1P8G3
ENSMLUP00000006464 ENSMLUP00000006464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]