SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000006484 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000006484
Domain Number 1 Region: 4-132
Classification Level Classification E-value
Superfamily PH domain-like 4.18e-55
Family Necap1 N-terminal domain-like 0.000000363
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000006484   Gene: ENSMLUG00000007096   Transcript: ENSMLUT00000007101
Sequence length 279
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429777:8851070:8861864:-1 gene:ENSMLUG00000007096 transcript:ENSMLUT00000007101 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAEVEYESVLCVKPDVSVYRIPPRASNRGYRASDWKLDQPDWTGRLRITSKGKIAYIKL
EDKVSGELFAQAPIEQHPGIAVETVTDSSRYFVIRIQDGTGRSAFIGIGFTDRGDAFDFN
VSLQDHFKWVKQESEISKESQEMDTRPKLDLGFKEGQTIKLSIGNITTKKGATSKPKTAG
TGGLSLLPPPPGGKVTIPPPSSSVAISNHVTPPPIPKSNHGGSDADILLDLDSPAPVPTP
APAPAPGPVSASSDLWGDFSTASSSVSNQAPQPSNWVQF
Download sequence
Identical sequences G1P8I1 S7P5P4
XP_005862811.1.60319 XP_006084264.1.53796 ENSMLUP00000006484 ENSMLUP00000006484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]