SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000006501 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000006501
Domain Number 1 Region: 6-291
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.62e-77
Family BAR domain 0.0051
Further Details:      
 
Domain Number 2 Region: 265-344
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000107
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000006501   Gene: ENSMLUG00000007111   Transcript: ENSMLUT00000007122
Sequence length 345
Comment pep:novel scaffold:Myoluc2.0:GL429795:3186371:3319807:-1 gene:ENSMLUG00000007111 transcript:ENSMLUT00000007122 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLPALEFSDCCLDSPHFRETLKSHEAELDKTNKFIKELIKDGKSLISALKNLSSAKRKF
ADSLNEFKFQCIGDAETDDEMCIARSLQEFASVLRNLEDERIRMIENASDVLITPLEKFR
KEQIGAAKEAKKKYDKETEKYCGILEKHLNLSSKKKESQLQEADSQVDLVRQHFYEVSLE
YVFKVQEVQERKMFEFVEPLLAFLQGLFTFYHHGYELAKDFSDFKMQLTISIQNTRNRFE
GTRSEVESLMKKMKENPLEHKTISPYTMEGYLYVQEKRECHFGTSWVKHYCTYQRDSKQI
TMVPFDQKSGGKGGEDESVTLKSCIRRKTDSIEKRFCFDVEAVDR
Download sequence
Identical sequences G1P8J4
ENSMLUP00000006501 ENSMLUP00000006501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]