SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000006507 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000006507
Domain Number 1 Region: 368-567
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.73e-54
Family BCR-homology GTPase activation domain (BH-domain) 0.0000373
Further Details:      
 
Domain Number 2 Region: 259-335
Classification Level Classification E-value
Superfamily SH3-domain 9.08e-16
Family SH3-domain 0.003
Further Details:      
 
Domain Number 3 Region: 144-243
Classification Level Classification E-value
Superfamily PX domain 0.00000000968
Family PX domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000006507   Gene: ENSMLUG00000007122   Transcript: ENSMLUT00000007130
Sequence length 2068
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430017:1194578:1299476:-1 gene:ENSMLUG00000007122 transcript:ENSMLUT00000007130 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METESESSTSGDDSVFWLDSEVVSQVTDSEGGGREETWRKMKSSVHSEEDDFVPELHRNV
HPRERPDWEETLSAMARGADVPEIPGDLSLKTCGSTASMKVKHVKKLPFTKGHFPKMAEC
AHFHYENVEFGSIQLSLSEEQNDVTKNGCESKELVYLVHIACQGKSWIVKRSYEDFRVLD
KHLHLCIYDRRFSQLSELPRSDALKDSPESVTQMLMAYLSRLSAIAGNKINCGPALTWME
IDNKGNHLLVHEESSINTPAVGAAHVIKRYTARAPDELTLEVGDIVSVIDMPPKVLSTWW
RGKHGFQVGLFPGHCVELINQKVPQSVTNSVPKPVSKKHGKLITFLRTFMKSRPTKQKLK
QRGILKERVFGCDLGEHLLNSGFEVPQVLQSCTAFIERYGIVDGIYRLSGVASNIQRLRH
EFDSEHVPDLTKEPYVQDIHSVGSLCKLYFRELPNPLLTYQLYEKFSDAVSAATDEERLI
KIHDVIQQLPPPHYRTLEFLMRHLSLLADYCSITNMHAKNLAIVWAPNLLRSKQIESACF
SGTAAFMEVRIQSVVVEFILNHVDVLFSGKISEVIQEGAASLSRPKSLLISSPSTKLLTL
EEAQARTQAQINSPLVTENKYIEVGEGPAALQGKFHTIIDFPLERRRPQNKMKKSPVGSW
RSFFNLGKSSSVSKRKLQRNESEPSEMKAMALKGGRAEGTLRSAKSEESLTSLHAVDGDS
KLFRPRRPRSSSDALSASFNGEMLGNRCNSYDNLPHDNESEEDVGLLHIPALVSPPSAED
VDLSPPDMGVAGLDFDPMSFQCSPPKAEAEGPEGGAAFLDSPTGYPKDKPSANKRDSEAG
GSRAQTPGSTASSEPMSPLRETPSPFFTLDKPSSFTEKVVYAFSPKIGRKLGKSPSLNIS
EPISVTLPPRPPQPPPRPSATAAQTRSPAWHTGVDESAVGTRSPPQVGKMKANEREALEG
CEPGVQPPGLAVAVAAAAEVEAPGQEKEEPCMSDGQSKAVPSGQAQTGAVTHDPPQEAMP
VSSVSLIPPPPPPKNVARLLALALAESAQQASTQSLKRPGACQSAPVNYGDAALAAAEEQ
LPVYHPHMTLDKACVPADGPAEHFLLPNHASGSGHQLLPDPAAAGHQAHASAPEPGQQPR
QADFQPHRACAPGDPDQARTTAGPLTDSQSDEHISFREDQPGKTTGPTVSFADQDQTQVH
FYSGDQPPSYLGASVDQPHQPSQLTDTSPTPSRDKPCPPPGSPEEPVSTAGLAYVAAAAA
ADTGAWEACWDPAEQPTAADFAAATLQRPHRTHRPLPPPPSQRPAEPSPAVGQVPATACA
GLNNSHKVPGVVPTPERPPQPRAADDPPPGLVGDGGAAAPCPASAPTRASPEKLREGPRA
PPLHLRAESAPVHPCGFPAPVPPTRTMESKVAAAIHCGGAEAAGGASYHPFASAAGDDVL
PLPLPAPQPKHAPQKAAYATFTRPDVTPEPFGPENCVHFNMTPNCQYRAQSVPPHHSGLE
PHHAYGARSEPPASVGPRYNTYVAPGRSASGHHSKPCSRVEYVSSLSSSVRGGCYPEDPY
PTIRRVQSLHTPPAAMIRSVPISRTEVPPDDEPAYCPRPLYQYKPYPASQARSDYHVTQL
QPYFENGRVHYRYSPYSSSSGSYYSPDGALCDVDAYGTVQLRPLHRLPSRDFAFHNPRLQ
GKSLYGYPGLPPRPRATVTGYFSGNDHGVIGMPPAADGKHTYTSWDFEDMEKYRMQSIRR
ESRARQKVKGPVMSQYDNMGPALQDELGGLYVIHLRSKSDPGKTGLLSVAEGKEARPPGK
ALSPEGGDPFYRKHPEAELDRAHYHGGHGGHGNGQPEKPSLPQKQSSLRNRKLHDPGCGL
PEHRAHQEASHRHLCEPKSGPPHPQGAGHLDYGAKGSPDACEPASYHNSGGKYMTVGPES
LRLNHKEARLCKELERPRARQPPAPDKHPRDCYPEDEPLGQASVPPPKPERSHSLKLHHT
QSGELCQYPAHGRRQGSLATVSQYDNLEGYHSPPQLQRGGFAGGAMGAYLPPGFAHPQSR
TYATALGQGAFLPAELSLQHPETQVHAE
Download sequence
Identical sequences G1P8J8
ENSMLUP00000006507 ENSMLUP00000006507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]