SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000006515 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000006515
Domain Number 1 Region: 473-686
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-51
Family DBL homology domain (DH-domain) 0.00042
Further Details:      
 
Domain Number 2 Region: 165-308
Classification Level Classification E-value
Superfamily PH domain-like 2.77e-41
Family Third domain of FERM 0.00043
Further Details:      
 
Domain Number 3 Region: 815-964
Classification Level Classification E-value
Superfamily PH domain-like 2.52e-33
Family Pleckstrin-homology domain (PH domain) 0.0019
Further Details:      
 
Domain Number 4 Region: 670-795
Classification Level Classification E-value
Superfamily PH domain-like 9.51e-31
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Domain Number 5 Region: 64-167
Classification Level Classification E-value
Superfamily Second domain of FERM 4.19e-29
Family Second domain of FERM 0.0000953
Further Details:      
 
Domain Number 6 Region: 2-64
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.69e-16
Family First domain of FERM 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000006515   Gene: ENSMLUG00000007123   Transcript: ENSMLUT00000007138
Sequence length 970
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429772:1340213:1390406:1 gene:ENSMLUG00000007123 transcript:ENSMLUT00000007138 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KCDGQVLLTQVWRRLNLIECDYFGLEFQNVPSYWIWLEPMKPISRQVRRPKNAMLRLAVK
FFPPDPGQLQEEYTRYLFALQLKRDLLEERLTCTDTTAALLTSHLLQSEIGDYDETLDRE
HLKVNKYLPNQECCLEKILEFHRKHMGQTPAESDFQVLEVARKLEMYGIRFHKASDREGA
KINLAVSHMGVLVFQSTTKINTFNWSRVRKLSFKRKRFLIKLHPEVHGPYQDTLEFLLGS
RDECKNFWKICVEYHTFFRLFDQPKPKAKAVLFSRGSSFRYSGRTQKQLVDYVKDGVMTR
TSYERRHSRTRTSGRALTTELPKQSPNTDTDSWGSEAESPLDVFCGCRKETPAVQPGPQE
GPARPKMPSGETPAEGAVALPPDHDEDKEGGVDGVQPFGGQHPQKATGSKQGSAHLTPLT
SSQQAGATPTSLLVTLGPAERGSSPLLSPVLSDAGGTRMDDEEEPKHKGTGADEAYFIAK
EILATERTYLKDLEVITVWFRSAVVKEDAMPADLMTLLFSNIDPIYEFHRGFLCEVEQRL
ALWEGPSGAQAPGSHQRIGDVLLRNMRQLKQFTGYFQRHDEVLTELEKATKRFKKLETVY
KEFELQKVCYLPLNTFLLKPIQRLVHYRLLLRRLCGHYAPGHHDYTDCCDALQVITEVTS
ILQHSLVRLENLQKLTELQRDLVGIENLIAPGREFIREGCLHKLTRKGLQQRMFFLFSDM
LLYTSRGVSGTSHFRIRGLLPLRGMLVEESKSEWSVPHCFTIYAAQKTIVVAASTELEKE
KWMHDLNNAIEAAKSGGNMTLALPGSAVCVPPRRPSDEVSLEQESEDDAHGPHSSSEGQG
QHRANTTVHVCWYRNTSVSRADHSAAVENQLSGYLLRKFKNSNGWQKLWVVFTNFCLFFY
KTHQDDYPLASLPLLGYSVSIPREADGIHKEHVFKLQFKSHVYFFRAESKYTFGRWMEVI
ERASSSPGKA
Download sequence
Identical sequences G1P8K6
ENSMLUP00000006515 ENSMLUP00000006515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]