SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000006519 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000006519
Domain Number 1 Region: 1038-1387
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.39e-96
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.000000327
Further Details:      
 
Domain Number 2 Region: 842-1032
Classification Level Classification E-value
Superfamily ARM repeat 4.32e-54
Family Phoshoinositide 3-kinase (PI3K) helical domain 0.000091
Further Details:      
 
Domain Number 3 Region: 352-518
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.75e-43
Family Ras-binding domain, RBD 0.02
Further Details:      
 
Domain Number 4 Region: 678-838
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.53e-35
Family PLC-like (P variant) 0.022
Further Details:      
 
Domain Number 5 Region: 1417-1535
Classification Level Classification E-value
Superfamily PX domain 2.09e-27
Family PX domain 0.0012
Further Details:      
 
Domain Number 6 Region: 1550-1677
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 8.4e-25
Family Synaptotagmin-like (S variant) 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000006519   Gene: ENSMLUG00000007089   Transcript: ENSMLUT00000007144
Sequence length 1682
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429891:2163949:2229428:1 gene:ENSMLUG00000007089 transcript:ENSMLUT00000007144 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQISSSNGFKQCSSSHLDPTRTKDVDKEEALQMEAEALAKLQKGRQVTDNQRGFELSSS
TRQRAQVYNKQDYDLMVFPESDTQKRAVDIDVEKLTQAELEKLLLDDSFETRKTPAMPVT
PILSPSFSAQLYLRPTIQRGQWPTGLSGPSTYTLPSIYQSTYSSKQTAFQNGFNPRMPTF
PSTEPIYLSLPGQSPYFSYPLTSATQFHPQGSLPICRPVVSPDMAKLFDKIASTSAFLKN
GKARTDLEITNSKATISNLQVSPKSEDISKFDWLDLDPLSKPKVDSVEVLDYEEEKNVPG
LLAEDPWDAVLLEERSLASCHLERKVNGKSLSGAMVTRSQSLNIRTTQGQISQKDPNGTS
SLPTGSSLLQEIEVQNEEVAAFCQSITKLKTNFPYTNHCTNPGYLLSPVTVQRNICGENA
SVKVSIEIEGFQLPVTFTCDVSSTVEIIIMQALCWVHDDLNEVDVGSYVLKVCGQEEVLQ
NNHCLGSHEHIQNCRKWDTEIKLQLLTLSAMCQNLARTAEDDETPVDLNKHLHQIEKPYK
EVMTRHPIEELLDSYHNQVELALRIENQHRAVDQVIRAVRKICSALDGVETPAITESVKK
LKRAVNLPRSKSADVTSGKGDPNKSSTRGSLNPENPVQVSMDQLTAAIYDLLRLHGNSGR
SSLDCAQSNRNIKEACTATEQLQFTIFAAHGISSNWVSNYEKYYLVCSLSHNGKDLFKPI
QSKKVGTYKNFFYLIKWDELIIFPIQISQLPLESLLHLTLFGILNQSSGSSPDSNKQRKG
PEALGKVSLPLFDFKRFLTCGTKLLYLWTSSHITPIPGTIPKKGYVMERIVLQVDFPSPT
FDIIYTTPQVDRNVIQQHNLETLGNDIKGKLLDILHKDSSLGLSKEDKAFLWEKRYYCLK
HPNCLPKILASAPNWKWVNLAKIYSLLQQWPPLDPLTALELLDSKFADQEVRCQAVTWME
AISDDELADLLPQFVQALKYEIYLNSSLVRFLLSRALGNIQIAHNLYWLLKDALHDAQFG
ARYEHVLGALLSVGGKGLREELLKQTKLVQLLGGVAEKVKQASGSARQVVLHRSMERVQS
FFLRNKCRLPLNPSLVAKELNIKSCSFFSSNAVPLKVTMVNTDPMGEEINVMFKVGEDLR
QDMLALQMIKIMDKIWLKEGLDLRMVIFKCLSTGRDRGMVELVPASDTLRKIQVEYGVTG
SFKDKPLAEWLRKYNPSEEEYEKASENFIYSCAGCCVATYVLGICDRHNDNIMLRSTGHM
FHIDFGKFLGHAQMFGSFKRDRAPFVLTSDMAYVINGGEKPTIRFQLFVDLCCQAYNLIR
KQTNLFLNLLSLMIPSGLPELTSIQDLKYVRDALQPQTTDAEATIFFTRLIESSLGSIAT
KFNFFIHNLAQLRFSGLPSNDEPILSFSPKTYSFRQDGRIKEVSVFTYHKKYNPDKHYIY
VVRILREGQLEPSFVFRTFDEFQELHNKLSIIFPLWKLPGFPNRMVLGRTHIKDVAAKRK
IELNSYLQSLMSASTDVAECDLVCTFFHPLLRDEKAEGIAKSADAGPFSPTPGQIGGSVK
LSVSYRNNTLFIMVMHIKDLVTEDGADPNPYVKTYLLPDPHKTSKRKTKISRKTRNPTFN
EMLVYSGYSKETLRQRELQLSVLSAESLRENFFLGGITLPLKDFNLSKETVKWYQLTAAT
YF
Download sequence
Identical sequences G1P8L0
ENSMLUP00000006519 XP_006093889.1.53796 ENSMLUP00000006519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]