SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000006542 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000006542
Domain Number 1 Region: 32-290
Classification Level Classification E-value
Superfamily Ras GEF 4.18e-80
Family Ras GEF 0.0000454
Further Details:      
 
Domain Number 2 Region: 454-572
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000115
Family Pleckstrin-homology domain (PH domain) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000006542   Gene: ENSMLUG00000007161   Transcript: ENSMLUT00000007169
Sequence length 574
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429821:4210427:4290647:1 gene:ENSMLUG00000007161 transcript:ENSMLUT00000007169 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLLNGQASSVNVAATASEKSSSSESLSDKGSELKKSFDAVVFDILKVTPEEYAGQITLM
DVPVFKAIQPDELSSCGWNKKEKYSSAPNAVAFTRRFNHVSFWVVREILHAQTLKIRAEV
LSHYIKTAKKLYELNNLHALMAVVSGLQSAPIFRLTKTWALLSRKDKTTFEKLEYVMSKE
DNYKRLRDYISSLKMTPCIPYLGIYLSDLTYIDSAYPSTGSILESEQRSNLMNNILRIIS
DLQQSCEYDIPMLPHVQKYLNSVQYIEELQKFVEDDNYKLSLKIEPGTSTPRSAASREDL
VGPELGSPQSGRSVAAEGALLPHTLPSPRNLIPHGHRKCHSLGYNFIHKMNTAEFKSATF
PNAGPTHLLDDSVMEPHAPSRGQAESSTLSSGISIGSSDGSELSEETSWPAFERNRLYHS
LGPMTRVARNGYRSHMKASSSAESEDLAVHLYPGAVTIQGVLKRKTLLKEGKKPTVASWT
KYWAALCGTQLFYYTAKSLKATERKHFKSTSNXWMVMMADDPDHPDFLLTDSEKGNSYKF
QAGNRMNAMLWFKHLSAACQSNKQQVPTNLMTFE
Download sequence
Identical sequences G1P8N1
ENSMLUP00000006542 ENSMLUP00000006542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]