SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000006551 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000006551
Domain Number 1 Region: 194-427
Classification Level Classification E-value
Superfamily PH domain-like 1.11e-86
Family SSRP1-like 0.00000495
Further Details:      
 
Domain Number 2 Region: 539-615
Classification Level Classification E-value
Superfamily HMG-box 6.68e-26
Family HMG-box 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000006551   Gene: ENSMLUG00000007168   Transcript: ENSMLUT00000007179
Sequence length 710
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429864:1427532:1436117:1 gene:ENSMLUG00000007168 transcript:ENSMLUT00000007179 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAETLEFNDIYQEVKGSMNDGRLRLSRQGIIFKNSKTGKVDNIQAGELTEGIWRRVALGH
GLKLLTKNGHVYKYDGFRESEFEKLADFFKTHYRLELMEKDLCVKGWNWGTVKFGGQLLS
FDIGDQPVFEIPLSNVSQCTTGKNEVTLEFHQNDDAEVSLMEVRFYVPPTQEDGVDPVEA
FAQNVLSKADVIQATGDAICIFRELQCLTPRGRYDIRIYPTFLHLHGKTFDYKIPYTTVL
RLFLLPHKDQRQMFFVISLDPPIKQGQTRYHFLILLFSKDEDISLTLNMNEEEVEKRFEG
RLTKNMSGSLYEMVSRVMKALVNRKITVPGNFQGHSGAQCITCSYKASSGLLYPLERGFI
YVHKPPVHIRFDEISFVNFARGTTTTRSFDFEIETKQGTQYTFSSIEREEYGKLFDFVNA
KKLNIKNRGLKEGMNPSYDDYADSDEDQHDAYLERMKEEGKIREENANDSSDDSGEETDE
SFNPGEEEEDVAEEKSSSVSARHVVNRSGHNSRGVKRIGEEYRASSLPHGGSQSELAHVK
KGKDPNAPKRPMSAYMLWLNASREKIKSDHPGISITDLSKKAGEIWKAMSKEKKEEWDRK
AEDARREYEKAMKEYEGGRGESSKRDKSKKKKKVKVKMEKKSTPSKGSSSKSSSRQLSES
FKSKEFVTSDDSSSGENKSKKKRRRSEDSEEEELASTPPSSEDSASGSDE
Download sequence
Identical sequences G1P8P0
ENSMLUP00000006551 ENSMLUP00000006551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]