SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000006579 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000006579
Domain Number 1 Region: 206-476
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.75e-84
Family Protein kinases, catalytic subunit 0.000000000266
Further Details:      
 
Domain Number 2 Region: 95-235
Classification Level Classification E-value
Superfamily SH2 domain 5.92e-38
Family SH2 domain 0.00000248
Further Details:      
 
Domain Number 3 Region: 35-120
Classification Level Classification E-value
Superfamily SH3-domain 3.02e-20
Family SH3-domain 0.0000381
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000006579   Gene: ENSMLUG00000007200   Transcript: ENSMLUT00000007211
Sequence length 1109
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429821:4406247:4427410:-1 gene:ENSMLUG00000007200 transcript:ENSMLUT00000007211 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EALHRPYGCDVEPQALNEAIRWSSKENLLGATESDPNLFVALYDFVASGDNTLSITKGEK
LRVLGYNQNGEWSEVRSKNGQGWVPSNYITPVNSLEKHSWYHGPVSRSAAEYLLSSLING
SFLVRESESSPGQLSISLRYEGRVYHYRINTTTDGKVYVTAESRFSTLAELVHHHSTVAD
GLVTTLHYPAPKCNKPTVYGVSPIHDKWEMERTDITMKHKLGGGQYGEVYVGVWKKYSLT
VAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTLEPPFYIVTEYMPYGNLLDYL
RECNREEVTAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHVVKVADFGLSRL
MTGDTYTAHAGAKFPIKWTAPESLAYNTFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQ
VYDLLEKGYRMEQPEGCPPKVYELMRACWKWSPADRPSFAETHQAFETMFHDSSISEEVA
EELGRAAAASSVVPYLPRLPILPSKTRTLKKQVENKENIEGSLDAPDNSASSSAPGFIRS
AQVPSGSPALPRKQRDKSPSSLLEDAKETCFTRDRKGGFFSSFMKKRNAPTPPKRSSSFR
EMENQPHKKYELTGNFSSVASLQHADGFSFTPAQQEANLVPPKCYGGSFAQRNLCNDDGG
GGGGSGTAGGGWSGITGFFTPRLIKKTLGLRAGKPTASDDTSKPFPRSNSTSSMSSGLPE
QDRMAMTLPRNCQRSKIQLERTVSTSSQPEESVDRANDTPPKKSEEGAAPTRERPKAKLL
PRGTTALPLRSPSGDPAITEKDCPGVGAAGVAAAPKSKERNGGARLGMAGVPEDGEQTGW
ASPAKVAAMLPTTHNHKVPVLISPTLKHTPADVQLIGTDSQGNKFKLLSEHQVTSSGDKD
RPRRVKPKCAPPPPPVMRLLQHPSVCSDPTEEPAAPAAGQPTSETQEGGKKAAPGAVPTS
GKAGRPVVPPPQVPLPTSSISPAKMANGTAGTKVALRKTKQAAEKISADKISKEALLECA
DLLSSAISEPVPNSQLVDTGHQLLDYCSGYVDCIPQTRNKFAFREAVSKLELSLQELQVS
SATAGVPGANPVLNNLLSCVQEISDVVQR
Download sequence
Identical sequences G1P8R6
ENSMLUP00000006579 ENSMLUP00000006579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]