SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000006613 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000006613
Domain Number 1 Region: 276-384
Classification Level Classification E-value
Superfamily SH2 domain 1.88e-25
Family SH2 domain 0.000000557
Further Details:      
 
Domain Number 2 Region: 388-428
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000000000955
Family SOCS box-like 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000006613   Gene: ENSMLUG00000007257   Transcript: ENSMLUT00000007248
Sequence length 441
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429958:231912:233237:-1 gene:ENSMLUG00000007257 transcript:ENSMLUT00000007248 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAENSESNSKNVDVRPKTSRSRSADRKDGYVWSGKKLSWSKKSESFSDAETVNVIEKTEV
PLQSQERKHSCSSIELDLDHSCGHRFLGRSLKQKLQDAVGQCFPIKNCSSRHSSGLPSKR
KIHISELMLDKCPFPPRSDLAFRWHFIKRHTAPINPKPDELISTDLSQSELRDGQPKQRR
NMEEEVNCFSHPNVQPCVITTSNASCSGGPMAGSLMNLVSNNSIEDSDMDSDDEIITLCT
SSRKRNKPKWEMDEEILQLGTTPKYHTQIDYVHCLVPDLLQINNNPCYWGVMDKYAAEAL
LEGKPEGTFLLRDSAQEDYLFSVSFRRYSRSLHARIEQWNHNFSFDAHDPCVFHSPDITG
LLEHYKDPSACMFFEPLLSTPLIRTFPFPLQHICRTVICNCTTYDGIDALPIPSSMKLYL
KEYHYKSKVRVLRIDAPKQQC
Download sequence
Identical sequences G1P8U6
XP_006097015.1.53796 XP_014318307.1.53796 ENSMLUP00000006613 ENSMLUP00000006613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]