SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000006631 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000006631
Domain Number 1 Region: 14-146
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.96e-41
Family BCR-homology GTPase activation domain (BH-domain) 0.00000622
Further Details:      
 
Domain Number 2 Region: 390-445
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000249
Family SH3-domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000006631   Gene: ENSMLUG00000007255   Transcript: ENSMLUT00000007266
Sequence length 446
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429906:1703243:1725780:1 gene:ENSMLUG00000007255 transcript:ENSMLUT00000007266 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLFSLAPKSPPDMDIDIELWDNKTITSGLKNYLRCLAEPLMTYKLHKDFILAVKSDDQNY
RVEAVHALVHKLPEKNREMLDILIKHLVKVSLHSQQNLMTVSNLGVIFGPTLMRAQEETV
AAMMNIKFQNIVVEILIEHYEKIFHTAPDPSIPLPQPQSRSGSRRTRAICLSTGSRKPRG
RYTPCLAEPDSDSYSSSPASTPMGSIESLSSHSSEQNSTTKSTSCQPREKSGGIPWIASP
SPSNGQKSLGLWTTSPESSSREDATKTDAESDCQSVASVTSPGDVSPHRDLAKKGSHGTS
GQKRASATFLRSLAAAEGNKSYSGSTQSLTSIGSKETPKAPPNPDLPPKMCRRLRLDTAS
SNGYQRPGSIVAAKAQLFENVGSVKPVSSGRQAKAMYSCQAEHSHELSFPQGALFSNVYP
SVEPGWLKATYEGKTGLVPENYVVFL
Download sequence
Identical sequences G1P8W3
ENSMLUP00000006631 ENSMLUP00000006631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]