SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000006672 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000006672
Domain Number 1 Region: 414-559
Classification Level Classification E-value
Superfamily CBS-domain pair 0.0000000000000316
Family CBS-domain pair 0.0092
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000006672
Domain Number - Region: 653-705
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.00629
Family cAMP-binding domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000006672   Gene: ENSMLUG00000007307   Transcript: ENSMLUT00000007312
Sequence length 948
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429833:422574:471665:-1 gene:ENSMLUG00000007307 transcript:ENSMLUT00000007312 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CRMAAAAAAVGVRLRDCCSRGAVLLLFFSLSPRPPAAAAWLLGLRPEDTAGGRVSLEGGT
LRAAEGTSFLLRVYFQPGPAAPAALVPVPTLSSGENGTGDLAPRLVFIEEPPGGSGLAPS
AVPTRPPGPQRCREQSDWASDVEVLGPLRPGGVAGSALVQVRVRELRKGEADKGGAGGGG
EPLLAVRPGDGRSWDHHGAGGFLLRVRPRLYGPEGLLTPAWLRALGALLLLALSALFSGL
RLSLLSLDPVELRVLRNSGSATEQEQARRVQAVRGRGTHLLCTLLLGQAGANAVLAGWLY
TSLPPGVGDPGEDYGEAGIHFPWLPALVCTGAVFLGAEICPYSVCSRHGLAIASHSVCLT
RLLMAAAFPVCYPLGRLLDWALRQEISTFYTREKLLETLRAADPYNDLVKEELNIIQGAL
ELRTKVVEEVLTPLGDCFMLRSDAVLDFSTVSEILRSGYTRIPVYEGDQRHNIVDILFVK
DLAFVDPDDCTPLLTVTRFYNRPLHCVFNDTRLDTVLEEFKKGKSHLAIVQRVNNEGEGD
PFYEVMGIVTLEDIIEEIIKSEILDETDLYTDNRKKQRVPHRERKRHDFSLFKLSDSEMR
VKVSPQLLLATHRFMATEVEPFKSLYLSEKILLRLLKHPHVIQELKFDDKNKKAPEHYLY
QRSRPVDYFVLLLQGKVEVEVGKEGLRFENGAFTYYGVPAIMTTSCSDNDVRKAGSLAGS
SAFLNRSPSRCSGLNRSESPNRERSDFGGSNTQLCSSNNLYTPDYSVHILSDVQFVKITR
QQYQNALTACHMDNSPQSPDMEAFTDGDSTKAPTTRGTPQTPKDDPAVILLNNRNSLPCS
RSDGLRSPGEVVYLRMEEMGFTQEDMTDFQEHSTQQLSVSPAAIPTRAASDSECCNINLD
TETSPCSSDFEETMGKRLLRTLSGRKRKRSPDGERASEENSNLTPLIT
Download sequence
Identical sequences G1P8Z7
ENSMLUP00000006672 ENSMLUP00000006672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]