SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000006688 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000006688
Domain Number 1 Region: 160-290
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.34e-31
Family Synaptotagmin-like (S variant) 0.000000836
Further Details:      
 
Domain Number 2 Region: 821-941
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.83e-23
Family Synaptotagmin-like (S variant) 0.0077
Further Details:      
 
Domain Number 3 Region: 8-114
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-19
Family PDZ domain 0.00000517
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000006688   Gene: ENSMLUG00000007311   Transcript: ENSMLUT00000007329
Sequence length 970
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429881:2645505:2834896:-1 gene:ENSMLUG00000007311 transcript:ENSMLUT00000007329 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HPVTWQPSKDGDRLIGRILLNKRLKDGSVPRDSGAMLGLKVVGGKMTESGRLCAFITKVK
KGSLADTVGHLRPGDEVLEWNGRLLQGATFEEVYNIILESKPEPQVELVVSRPIGDIPRI
PDSTHAQLESSSSSFESQKMDRPSISVTSPMSPGMLRDVPQFLSGQLSIKLWFDKVGHQL
IVTILGAKDLPSREDGRPRNPYVKIYFLPDRSDKNKRRTKTVKKTLEPKWNQTFIYSPVH
RREFRERMLEITLWDQARVREEESEFLGEILIELETALLDDEPHWYKLQTHDVSSFPLPH
PSPYMPRRQLHGQNPSIDFSGSKRISDSEISDYDCDDGIGVVSDYRHNGRDLQSSTLSVP
EQVMSSNHCSPSGSPHRVDVIGRTRSWSPSVPPPQSRNVDQGLRGTRSTTGHYNTISRMD
RHRVMDDHYSPDRDRDCEAADRQPYHRSRSTEQRPVLERTTARSRSTERPDTNLMRSMPS
LMTGRSAPPSPALSRSHPRTGSVQTSPSSTPVAGRRGRQLPQLPPKGTLERSAMDIEERN
RQMKINKYKQVAGSDPRLEQDYHSKYRSGWDPHRGADNISTKSSDSDVSDISAVSRTSSA
SRFSSTSYMSVQSERPRGSKKIRSSPLVPSHPPPTPRHPKVLPLAPAYSVFTSKMQSRQV
GASGKNMTKSTSISGDMCSLEKSEGSQSDTAVGALGPGGHKRRSSIGAKMVAIVGLSRKS
RSASQLSQTVCAEAGGKKLRSTVQRSTETGLAVEMRNWMTRQASRESTDGSMNSYSSEGN
LIFPGVRLASDSQFSDFLDGLGPAQLVGRQTLATPAMGDIQVGMMDKKGQLEVEIIRARG
LVVKPGSKTLPAPYVKVYLLDNGVCVAKKKTKVARKTLEPLYQQLLSFEESPQGKVLQII
VWGDYGRMDHKSFMGVAQILLDELELSNMVIGWFKLFPTSSLVDPTLAPLTRRASQSSLE
SSTGPSYSRS
Download sequence
Identical sequences G1P910
ENSMLUP00000006688 ENSMLUP00000006688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]