SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000006705 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000006705
Domain Number 1 Region: 172-304
Classification Level Classification E-value
Superfamily PH domain-like 8.33e-39
Family Pleckstrin-homology domain (PH domain) 0.000000882
Further Details:      
 
Domain Number 2 Region: 384-495
Classification Level Classification E-value
Superfamily SH2 domain 1.25e-24
Family SH2 domain 0.00000625
Further Details:      
 
Domain Number 3 Region: 24-85
Classification Level Classification E-value
Superfamily Phenylalanine zipper 2.62e-22
Family Adapter protein APS, dimerisation domain 0.0000201
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000006705   Gene: ENSMLUG00000007328   Transcript: ENSMLUT00000007346
Sequence length 623
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429812:6806821:6818022:-1 gene:ENSMLUG00000007328 transcript:ENSMLUT00000007346 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGAASGPAAPAAPVPVPVPVPVPDWRQFCELHAQAAAVDFAHKFCRFLRDNPAYDTPDA
GASFSRHFAANFLDVFSEEVRRVLAAERADAMEPRPAALKAAACGHSRSSEDVSARAAAK
ARVRKGFSLRNMSLCVVDGVRDMWHRRASPEPDAAARAPEPPADARDRWTRRWRLSRTLA
AKVELVDIQREGALRFMVADDAAAGPGAAQWQKCRLLLRRAVAGERFRLEFFVPPKASRP
KVSIPLSAIIEVRTTMPLEMPEKDNTFVLKVENGAEYILETIDSLQKHSWVADIQGCVDP
GDSEEDAELSCARGGCLASRMASCSCELLTEAVDLPRPPETTAAVVTAPHSRARDAVGES
LVHVPLETFLETLESPGGSGGDSSNTGEEGAEPEPEVAPELELSDYPWFHGTLSRVKAAQ
LVLAGGPRSHGLFVIRQSETRPGEYVLTFNFQGKAKHLRLSLNGHGQCHVQHLWFQSVLD
MLRHFHTHPIPLESGGSADITLRSYVRVQGPPPDPGPSPSAAPAPPACWSEPAGQHYFSS
LAACPPASPSEAGGASSSSASSSSAASLPAAPRTTEGLLSARSRSNSAERLLEASGAEEP
PEAAPGDGSRGRTRAVENQYSFY
Download sequence
Identical sequences G1P924
XP_014310887.1.53796 XP_014310888.1.53796 XP_014310889.1.53796 XP_014310890.1.53796 ENSMLUP00000006705 ENSMLUP00000006705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]