SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000006733 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000006733
Domain Number 1 Region: 25-150
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.64e-29
Family G proteins 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000006733   Gene: ENSMLUG00000007385   Transcript: ENSMLUT00000007376
Sequence length 192
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429894:668122:673549:-1 gene:ENSMLUG00000007385 transcript:ENSMLUT00000007376 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EAGSQGGLLRKTERDRDWARSGLQEKNNHILVLGLDGAGKTSVLYSLALNRVQHSKAPTQ
GFNEVCISTEHSQMEFLEIGGSEPFRSYWEVYVSRGMLLIFVVDSADHSRLPEAKKYLHR
LIKINPVIPLVVFANKQDLKAAYHITDIHEALALSDVGNDRTMFLFGTQVTENGSEIPST
MQDAKDLIAHLA
Download sequence
Identical sequences G1P950
ENSMLUP00000006733 ENSMLUP00000006733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]