SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000006780 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000006780
Domain Number 1 Region: 6-302
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.47e-61
Family BAR domain 0.000000286
Further Details:      
 
Domain Number 2 Region: 278-373
Classification Level Classification E-value
Superfamily PH domain-like 2.17e-23
Family Pleckstrin-homology domain (PH domain) 0.0000152
Further Details:      
 
Domain Number 3 Region: 474-609
Classification Level Classification E-value
Superfamily PH domain-like 7.87e-21
Family Phosphotyrosine-binding domain (PTB) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000006780   Gene: ENSMLUG00000007408   Transcript: ENSMLUT00000007429
Sequence length 662
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429870:4086383:4127820:1 gene:ENSMLUG00000007408 transcript:ENSMLUT00000007429 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAVDKLLLEEALQDSPQTRSLLSVFEEDAGTLTDYTNQLLQAMQRVYGAQNEMCLATQQ
LSKQLLAYEKQNFALGKGDEEVISTLHYFSKVVDELNVLHTELAKQLADTMVLPIVQFRE
KDLTEVSTLKDLFGLASTEHDLSMAKYSRLPKKKENEKVKTEVVKEVAAARRKQHLSSLQ
YYCALNALQYRKRMAMMEPMVGFAHGQINFFKKGAAMFSQSMDNFLSSVSDMVQSIQVEL
EAEAEKMRVSQQELLSVDESVYTPDFDVAAPQINRNLIQKAGYLNLRSKTGLVTTSWERL
YFFTQGGNLMCQPRGAVAGGLIQDLDNCSVMAVDCEDRRYCFQITTPNGKSGIILQAESR
KENEEWICAINNISRQIYLTDNPEAVAIKLNETALQAVTPITSFRKKQESSCPSQNLENS
EVKNDNTVPKATVSVPEAEELIAPGTPIQFDIVLPATEFLDQNRGSRRMNPFGETEDDAF
PEAEDSLLQQMFIVQFLGSMAVKTDDTTEVIYEAMRQVLAARAIHNIFRMTESHLMVTSQ
MLRLIDPQTQVSRANFELTSVTQFAAHQENKRLVGFVVRLPESTGGESLSTYVFESNSEG
EKICYAINLGKEINEVQKDPEALAQLMLSVPLTNDGKYVLLNDQPEDNDGSPRENTGAES
EA
Download sequence
Identical sequences G1P990
XP_006092802.1.53796 ENSMLUP00000006780 ENSMLUP00000006780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]