SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000006812 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000006812
Domain Number 1 Region: 1928-2228
Classification Level Classification E-value
Superfamily BEACH domain 1.96e-125
Family BEACH domain 0.00000000901
Further Details:      
 
Domain Number 2 Region: 2349-2600
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.23e-28
Family WD40-repeat 0.0022
Further Details:      
 
Domain Number 3 Region: 1804-1887
Classification Level Classification E-value
Superfamily PH domain-like 7.99e-24
Family PreBEACH PH-like domain 0.0051
Further Details:      
 
Domain Number 4 Region: 527-676,709-755
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000023
Family Pentraxin (pentaxin) 0.037
Further Details:      
 
Domain Number 5 Region: 11-351,409-495,799-822,863-1013
Classification Level Classification E-value
Superfamily ARM repeat 0.000000791
Family Regulatory subunit H of the V-type ATPase 0.089
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000006812
Domain Number - Region: 874-947,1040-1212
Classification Level Classification E-value
Superfamily ARM repeat 0.00863
Family HEAT repeat 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000006812   Gene: ENSMLUG00000007434   Transcript: ENSMLUT00000007463
Sequence length 2639
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429770:7641521:7723723:1 gene:ENSMLUG00000007434 transcript:ENSMLUT00000007463 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LHCVQKMEDGLEEQQQALSILLVKFFIILCRNLSNVEEIGTCSYINHVITMTTLYIQQLK
SKKKEKELADQTSIEEFVIHALAFCESLYDPYRNWRHRISGRILSTVEKSRQKYKPASLT
VEFVPFFYQCFQESEHLKESLKCCLLHLFGAIIAGGQKNALQAISPATMEVLMRVLADCD
SWEDGNPEEVGRKVELTLKCLTEVVHILLTSSSDQRQVETSTLLENYFKLLNSDHSALPN
QRRSREWESRFIALQIKMLNTITAMLDCTDRPVLQAIFLNSNCFEHLIRLLQNCKLFLNA
NNKVADKNEKDLANKLLTEINEDQAFQGQLDCLAVSTIQALTAIMSKSPAAKEVFKERIG
YAHMFEVLKSLGQPSLELLKELMNMAVEGDHTSVGILGISNVQPLLLLIQWLPELESQDL
QIFISDWLKRICCINRQSRTTCVNSNMGIRIIETLDSHSSLHRTCAENLIALHGSLGSQS
VSSEEIRRLLRLLRVDESEYIHPYTIPVTRAILTMARKQSLESALQYFNLSHSMAGISVP
SIQKWPGSAFSFNAWFCLDQDQLTLGNANKGGKRKQLYSFFTGSGMGFEAFITHSGMLVV
AVCTKREYATVMLPDHSFCDSLWHNITIVHMPGKRPFGQSLVYIYDNGQQKVSAPLRFPA
MNEPFISCCIGSAGQRTTTPPPSQIPDPPFSSPIEKSKLMTKLISAGTQDSEWGCPTSLE
GQLGSVIIFCEAIQPPQVKALYLAGPNCLSPWKFQESDMADLPGNVLLHYTAKACKNSIC
LDLSTNCLHGRLTGNKVVNWDIKDIVNCIGGLNVLFPLLEQISHFSEEQIPEGINEITVS
ELITPVEGDWVIPTSPKTSESRLERSLVATFILIVKHLIQRHPINQDNLIHSHGVATLGA
LLQKMPSTLMDVNVLMAIQLLIEQVSLEKNMQLLQQMYQYLLFDFHIWNRGDFPFRIGHI
QYLSTIIKDSRRVFRKKYGVQFLLDTLRIYYGSDCKYSELSLDDIRTIRTSLYGLIKYFL
CKGGTHEEIQSIMGYIAAINEEEQLFGILDILFSLLRTSPTRGQLFLLLFEPGNADILYA
LLLNQKYSDRLREIIFKVMEQMLKCTNVYERSKQRIRLREVGYSGLGLLLNETPVSTSLI
KNLINQIINTDPAINFKDLLSVVYISHRTYINVRVVICRKILQILQSQPDAAHQISQQVG
WQDTLVRLFVKEKTDDEKINSFASANVSSDQWSLDDRHSLDSNTPLFQEDSSVGELSFKS
ENQEEFWHSNPSHLSLDLSGIDSCELSDSGSQMPDSLPSTPSPIESTKSFSVQSDKESSI
TNDTGFCDDFSLLESKVPGSSRHFNNMLKDYKRCEEELLQLLTNILIYVMCKGLEKSDDD
TWIERGQVFSALTKSVISSELLRPSDEIKLILLQKMLEWAVTENREAKTNPVTAENAFRL
MLIIQDFLQSEGLVNSNTWTEKLLEDMMLLFDCLSVWYSESPLWVKLSQIQIQLLLGFIG
RGNLQVCAVASAKLNTLLQTKVIESQDEACYILGKLEHVLSQSIKEQTEIYSFLIPLVRT
LVSKIYELLFMNLHLPSLPFTNGSSSFFEDFQEYCSSSEWQVYIEKYIIPYMKQYETHTF
YDGHENMAVYWKDCYEALMVNMHKRDREGGESKLKFQEFFVEPFNRKARQENLRYNNMLK
QLNTQQLATLRRWKTIQIYLTCERGPWAERKQNPIHWKLANVENYSRMRLKLVPNYNFKT
HDEASALRDNLGVQPSQPSSDSLLLEVVKQVKVSDMEEDKLDISEEEITSRVNIDENKEQ
DQKEKLVFSVDCELITIIDIIPGRLEITTQHIYFYDGSIEKEDGVGFDFKWPHSQVREIH
LRRYNLRRSAIEIFHVDQSNYFLNFKKEVCKMLPFWKPQMSYNETLESILSSSQNVRNKV
YSRLLSFHSPNSYGTRSPQELFKASGLTQKWVNREISNFDYLIQINTMAGRTYNDLAQYP
VFPWILQDYTSEELDFNNPSVFRDLSKPIGVVNDKNAKVMREKYENFEDPMGTIDKFHYG
THYSNSAGVMHYLIRTEPFTTLHIQLQSGRFDCADRQFHSIPATWQALMDNPNDVKELIP
EFFYFPEFLENQNQFNLGRLQVSKELVNDVILPKWAKSAEDFIYKHRKALESEYVSAHLH
EWIDLIFGYKQRGPAAVEALNVFYYCSYEGAVDLDALTDEKERKALEGMINNFGQTPCQL
LKEPHPPRLSAEEAMQKQTKTETSTLNLFQHLPELKSFFIEGISDGIPLIKAIVPKNQSR
SFMSQGSPELLITVSMNYVIGTHGWLPYDRNISNYFTFFKDQTVTNPKTQRSLNGPFAPG
LEITSKLFIVSHDAKLLFSAGHWDNSIQVMSLTKGKIISHNIRHMADIVTCLATDYCGIH
LISGSRDTTCMIWQITQQGGVPVGLASKPFQILYGHTDEVLSVGISTELDMAVSGSRDGT
VLIHTIQKGQYLRTLRPPCESSLLLTIPNLAISWEGHIVIYSSTEEKTTLKDKNALHLFS
VNGKCLGSQVLKEQVSDICIIGEHIVMGSLQGFLSIRDLHSLNPSVTPLSMRMPIHCVSV
TKEYSHILVGLEDGKLIIVGVGKPAEMRSGQLSRKLWGSSKRLSQISSGETEYNTQDSN
Download sequence
Identical sequences G1P9B6
ENSMLUP00000006812 ENSMLUP00000006812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]