SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000006884 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000006884
Domain Number 1 Region: 279-376
Classification Level Classification E-value
Superfamily PDZ domain-like 6.7e-25
Family PDZ domain 0.008
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000006884
Domain Number - Region: 85-192
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00392
Family Myosin rod fragments 0.01
Further Details:      
 
Domain Number - Region: 169-207
Classification Level Classification E-value
Superfamily Leucine zipper domain 0.00619
Family Leucine zipper domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000006884   Gene: ENSMLUG00000007543   Transcript: ENSMLUT00000007540
Sequence length 465
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429824:1899732:1925375:-1 gene:ENSMLUG00000007543 transcript:ENSMLUT00000007540 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAGGPCPAGAGGGPGGASCAVGVSPGGVSMFRWLEVLEKEFDKAFVDVDLLLGEIDPDQ
ADITYEGRQKMTSLSSCFAQLCHKVQTVSQINHKLEAQLVDLKSELTETQAEKVVLEKEV
HDQLLQLHSVQLQLHAKTGQSVDSGTIKAKLLKSVPSVEELERELEANKKEKMKEAQLEA
EVKLLRKENEALRRHIAVLQAEVYGARLAAKYLDKELAGRVQQIQLLGRDMKGPAHDKLW
NQLEAEIHLHRHKTVIRACRGRNDLKRPMQAPPGHDQDSLKKSQGVGPIRKVLLLKEDYE
GLGISITGGKEHGVPILISEIQPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILS
QQRGEIEFEVVYVAPEVDSDDENVEYEDESGHRYRLYLDELEGGSNPGATCKDTSGEVKV
LQGFNKKSVTDGHENGDLGTSRETPLEDSAAKLDDLHSLYQRKSC
Download sequence
Identical sequences G1P9H6
ENSMLUP00000006884 ENSMLUP00000006884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]