SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000006897 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000006897
Domain Number 1 Region: 172-279,358-654
Classification Level Classification E-value
Superfamily ARM repeat 1.02e-16
Family Plakophilin 1 helical region 0.055
Further Details:      
 
Domain Number 2 Region: 7-92
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000341
Family Pentraxin (pentaxin) 0.066
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000006897
Domain Number - Region: 1830-1870
Classification Level Classification E-value
Superfamily PH domain-like 0.00258
Family PreBEACH PH-like domain 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000006897   Gene: ENSMLUG00000007481   Transcript: ENSMLUT00000007555
Sequence length 1874
Comment pep:novel scaffold:Myoluc2.0:GL429774:18677912:19201698:1 gene:ENSMLUG00000007481 transcript:ENSMLUT00000007555 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FNFFSFKWYMISIVHIYNRWRNSEIRCYVNGQLVSYGDMAWHVNTNDSYDKCFLGSSETA
DANRVFCGQLGAVYVFSEALNPAQIFAVHQLGPGYKSTFKFKSESDIHLAEHHKQVLYDG
KLATSIAFTYNAKATDAQLCLESSPKENASIFVHSPHALMLQDVKAIVTHSIHSAIHSIG
GIQVLFPLFAQLDNRQLNDSQVETTVCATLLAFLVELLKSSVAMQEQMLGGKGFLVIGYL
LEKSSRVHITRAVLEQFLSFAKYLDGLSHGAPLLKQLCDHILFNPAIWIHTPAKVQLSLY
TYLSAEFIGTATIYTTIRRVGTVLQLMHTLKYYYWVINPADSSGITPKGLDGPRPSQKEI
ISLRAFMLLFLKQLILKDRGVKEDELQSILNYLLTMHEDENIHDVLQLLVALMSEHPASM
IPAFDQRNGIRVIYKLLASKSESIWVQALKVLGYFLKHLGHKRKVEIMHTHSLFTLLGER
LMLHTNTVTVTTYNTLYEILTEQVCTQVVHKPHPEPDSTVKIQNPMILKVVATLLKNSTP
SAELMEVRRLFLSDMIKLFSNSRENRRCLLQCSVWQDWMFSLGYINPKNSEEQKITEMVY
NIFRILLYHAIKYEWGGWRVWVDTLSIAHSKVTYEAHKEYLAKMYEEYQRQEEENIKKGK
KGNVSTISGLSSQTTGAKGGMEIREIEDLSQSQSPESETDYPVSTDPGDLLMSTKVSDDI
LVNSDRPRSGVHVEVHDLLVDIKAEKVEATEVKLDDMDLSPETLVGGENGALVEVESLLD
NVYCAAVEKLQNNVHGSVGIIKKNEEKDNGPLITLADEKDDLPNSSTSFLFDKIPKQEEK
LLPELSSNHIIPNIQDTQVHLGVSDDLGLLAHMTGSVDLTCASIIEEKEFKIHTTSDGMS
SISERDLSSKGLEYAEMTATTLETESSGSKILPSIDAGSIVSDTERSDDGKESGKEIRKI
QTTTTTQAVQGRSLTQQDRDLRVDLGFRGMPMTEEQRRQFSPGPRTTMFRIPEFKWSPMH
QRLLTDLLFALETDVHVWRSHSTKSVMDFVNSNENIIFVHNTIHLISQMVDNIIIACGGI
LPLLSAATSPSTELENIEVTQGMSAETAVTFLSRLMAMVDVLVFASSLNFSEIEAEKNMS
SGGLMRQCLRLVCCVAVRNCLECRQRQRDRGNKSSHGSSKPQEATQSMTAIAASKNSLEN
VPGNLSPIKDPDRLLQDVDINRLRAVVFRDVDDSKQAQFLALAVVYFISVLMVSKYRDIL
EPQRETARIGSQPGRNIRQEINSPTSTVVVIPSIPHPTLNHGFLAKLIPEQSFAHSFYKE
TPAAFPDTIKEKETPTPGEDIQLESSIPHTDSGIGEEHVVSILNGAELEPSAGPDAMSEL
LSTLSSEVKKSQESLTENPSEILKPAPSISSISQTKGINVKEILKSLVAAPVEIAECGPD
PIPYPDPALKREAQAILPMQFHSFDRSVVVPVKKPPPGSLAVTTVGATAAGSGLPTGSTS
NIFAATGATPKSMINTTETGAVDSGSSSSSSSSSFVNGATSKNLPAVQTVAPMPEDSAEN
MSITAKLERALEKVAPLLREIFVDFAPFLSRTLLGSHGQELLIEGLVCMKSSTSVVELVM
LLCSQEWQNSIQKNAGLAFIELINEGRLLCHAMKDHIVRVANEAEFILNRQRAEDVHKHA
EFESQCAQYAADRREEEKMCDHLISAAKHRDHVTANQLKQKILNILTNKHGAWGAVSHSQ
LHDFWRLDYWEDDLRRRRRFVRNAFGSTHAEALLKAAIEYGTEEDVVKSKKTFRSQAIVN
QNAETELMLEGDDDAVSLLQEKEIDNLAGPVVLSTPAQLIAPVVVAKGTLSITTTEIYFE
VDEDDPAFKKIDSK
Download sequence
Identical sequences G1P9I9
ENSMLUP00000006897 ENSMLUP00000006897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]