SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000006913 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000006913
Domain Number 1 Region: 477-745
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.74e-73
Family Protein kinases, catalytic subunit 0.000000000356
Further Details:      
 
Domain Number 2 Region: 215-268
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000141
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00049
Further Details:      
 
Domain Number 3 Region: 143-215
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000227
Family Ras-binding domain, RBD 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000006913   Gene: ENSMLUG00000007544   Transcript: ENSMLUT00000007571
Sequence length 792
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429908:367208:451583:-1 gene:ENSMLUG00000007544 transcript:ENSMLUT00000007571 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAPQLPNRPCSEPNQGLHLGIGPALCHPGSRPKPVWNIKQMIKLTQEHIEALLDKFGGEH
NPPSIYLEAYEEYTSKLDALQQREQQLLESLGNGTDFSVSSSASTDTVTSSSSSSLSVLP
SSLSVFQNPTDVSRSNPKSPQKPIVRVFLPNKQRTVVPCIYTLNYRPSLIKALYRHALLI
NTTIVYKVPGKEKKPIGWDTDISWLTGEELHVEVLENVPLTTHNFVRKTFFTLAFCDFCR
KLLFQGFRCQTCGYKFHQRCSTEVPLMCVNYDQLDLLFVSKFFEHHPIPQEEASFAETTL
TSGSSPSTYSSDSFGPQMLTSPSPSKSIPIPQPFRPADEDHRNQFGQRDRSSSAPNVHIN
TIEPVNIDDLIRDQGFRSDGAPLNQLMRCLRKYQSRTPSPLLHSVPSEIVFDFEPGPVFR
GSTTGLSATPPASLPGSLTNVKALQKSPGPQRERKSSSSSEDRNRMKTLGRRDSSDDWEI
PDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMVLTAPTLSSYRAFLIGEISFYRKTRHVN
ILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSI
IHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWSGSHQFEQLSGSILWMAPEVIRMQDKNP
YSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRL
MAECLKKKRDERPLFPQILASIELLARSLPKIHRSASEPSLNRAGFQTEDFSLYACASPK
TPIQAGGYGAFP
Download sequence
Identical sequences G1P9K1
ENSMLUP00000006913 ENSMLUP00000006913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]