SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000006936 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000006936
Domain Number 1 Region: 2-54
Classification Level Classification E-value
Superfamily SH3-domain 0.000000163
Family SH3-domain 0.0032
Further Details:      
 
Domain Number 2 Region: 598-1004,1037-1141
Classification Level Classification E-value
Superfamily ARM repeat 0.00000247
Family Armadillo repeat 0.047
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000006936
Domain Number - Region: 436-490
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0517
Family PLC-like (P variant) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000006936   Gene: ENSMLUG00000007528   Transcript: ENSMLUT00000007596
Sequence length 1987
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430381:56855:196085:1 gene:ENSMLUG00000007528 transcript:ENSMLUT00000007596 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVTCSFRGSVPQGLVLEIGETVQILEKCEGWYRGVSTKKPNVKGIFPANYIHLKKAIVSN
RGQYETVVPLEDSIVTEVTATLQEWASLWKQLYVKHKVDLFYKLRHVMNELIDLRRQLLS
GHLTQDQVREVKRHITVRLDWGNEHLGLDLVPRKDFEVVDSDQISVSDLYKMPKQRRRQQ
GSPRMPVPHHFFLSLKSFTYNTIGEDTDVFFSLYDTREGKQISERFLVRLNKNGGPRNPE
KIERMCALFTDLSSKDMKRDLYIVAHVIRIGRMLLNDSKKGPAHLHYRRPYGCAVLSVLD
VLQSLTELKEEKDFVLKVYTCNNEGEWSQIHENIIRKSSAKYSAPSASHGLIISLQLLRG
DMEQIRRENPMIFSRGLAITRKLGFPDVIMPGDIRNDLYLTLEKGDFERGGKSVQKNIEV
TMYVLYADGEILKDCISLGSGEPNRSSYHSFVLYHNNSPRWGEIVKLPIPIDRFRGSHLR
FEFRHCSTKDKGEKKLFGFAFSPLMRDDGTTLSDDIHELYVYQCDENSTFNNHALYLGLP
CCKEDYNGCPNIPSSLIFQRSTKESFFISTQLSSTKLTQNVDLLALLKWKAFPDRIMDIL
GRLRHVSGEEIVKFLQDILDTLFVILDDNTEKYGLLVFQSLVFIINLLRDIKYFHFRPVM
DTYIQKHFAGALAYKELIRCLKWYMDCSAELIRQDHIQEAMRALEYLFKFIVQSRILYSR
ATCGMEEEQFRASIQELFHSIRFVLSLDSRNSETLLFTQAALLNSFPTIFDELLQMFTVQ
EVAEFVRGTLGSMPSTVHIGQSMDVVKLQSIARTVDSRLFSFSGSRRILLPVVLHHIHLH
LRQQKELLICSGILGSIFSIVKTSSLEADVMEEVEMMVESLLDVLLQTLLTIMSKSHAQE
AQYSPSVSSYVDLMGEYVSCLLSLLRQMCDTHYQHLLDNFQSKDELKEFLLKTFCVFRNL
MKMSVFPRDWMVMRLLTSNVIVTTVQYLSSALHKNFTETDFDFKVWNSYFSLAVLFINQP
SLQLEIITSAKRKKILDKYGDMRVMMAYELFSMWQNLGEHKIHFIPGMIGPFLGVTLVPQ
PEVRNIMIPIFHDMMDWEQRKNGNFKQVESELIDKLDSMVSEGKGDESYRELFGLLTQLF
GPYPSLLEKIEQETWRETGISFVTSVTRLMERLLDYRDCMKGEETENKKVGCTVNLMNFY
KSEINKEEMYIRYIHKLCDMHLQAENYTEAAFTLLLYCELLQWEERPLREFLHYPSQTEW
QRKEGLCRKIIHYFSKGKSWEFGIPLCRELACQYESLYDYQSLSWIRKMEASYYDSIMEQ
QRLEPEFFRVGFYGRKFPFFLRSQCWLQFSAHASQHADGKVQRLLDMFGILSPWRNHWSQ
CAVSLASRQKTDLQIYAVTPIPDCVDVLQMDRVPDRVKSFYRVNNVRKFRYDRPFHKGPK
DKENEFKSLWIERTTLTLTHSLPGISRWFEVERRELVEVSPLENAIQVVENKNQELRALI
GQYQHKQVHGNINLLSMCLNGVIDAAVNGGIARYQEAFFDKDYITKHPGDAEKIAQLKEL
MQEQVHILGVGLAVHEKFVHPEMRPLHKKLIDQFQMMRASLYHQEFPGLDKPSPACSGSS
TPRGGVLASHSPVSPESLKMTHRHSPMNLMGTGRHSSSSLSSHASSEAGNVVMLGDGPMG
EAPEDLYHHMQASPSSSSLSSTHSAPSQMIASAPSSARGSPSLPDKYRHAREMMLLLPTH
RDRPSSAMYPAAVLENGQPALFHQVIGACKPCSDPNLSVAEKAVPAAPSSWSLDSGVREA
QPFLSAHMGRILAPPVPPRSLLHGKKTSSGSPDSPWSPALLRGKSPLHPIPASPTSPQSG
LDGSNSTLSGSASSGVSSLSESNFGHPSEAPPRTDTMDSMPSQAWHADEDLEPPYLPVHY
SLSESAVLDSIKAQPCRSHSAPDPMDPPALPPKPYHPRLPALEHDEGVLLREEADRPRGL
HRKASLP
Download sequence
Identical sequences G1P9M3
ENSMLUP00000006936 ENSMLUP00000006936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]