SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000006973 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000006973
Domain Number 1 Region: 105-416
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 6.96e-72
Family Arginine methyltransferase 0.00000348
Further Details:      
 
Domain Number 2 Region: 31-84
Classification Level Classification E-value
Superfamily SH3-domain 5.12e-16
Family SH3-domain 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000006973   Gene: ENSMLUG00000007631   Transcript: ENSMLUT00000007639
Sequence length 433
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429930:2943124:2967898:-1 gene:ENSMLUG00000007631 transcript:ENSMLUT00000007639 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATSGDCPGSESQGREEPVEHCEQHLPEGVHPEEFVAIADYSATDETQLSFLRGEKILIL
RQTTADWWWGERAGYCGYIPANHLGKDLEECDPEDTWQDEEYFGSYGTLKLHLEMLTDQP
RTTKYHHVILQNRASLKDKVILDVGCGTGIISLFCAHYAQPRAVYAVEASEMAQHTGQLV
MQNGFADIITVFQQKVEDVVLPEKVDVLVSEWMGTCLLFEFMIESILYARDAWLKEGGII
WPTTAALHLVPCSADKDYRSKVLFWDNAYEFNLSALKSLAIKEFFSKPKYNHILKPEDCL
SEPCTILQLDMRTVQIAELETMKGELCFDIKKAGTLHGFTAWFSVRFQNLEEEEPQLVLS
TGPFHPTTHWKQVLFMMDEPVPVHAGDVLTGSIVLQRNPVWRRHMSVALSWSVTSRQDPT
LQRVGEKVFPIWR
Download sequence
Identical sequences G1P9Q5
XP_005878962.1.60319 XP_006096020.1.53796 XP_014317424.1.53796 ENSMLUP00000006973 ENSMLUP00000006973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]