SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000006989 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000006989
Domain Number 1 Region: 545-696
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.75e-61
Family Ankyrin repeat 0.0000161
Further Details:      
 
Domain Number 2 Region: 32-265,300-325
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.23e-52
Family BAR domain 0.021
Further Details:      
 
Domain Number 3 Region: 428-545
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 2.35e-35
Family Pyk2-associated protein beta ARF-GAP domain 0.0000206
Further Details:      
 
Domain Number 4 Region: 283-397
Classification Level Classification E-value
Superfamily PH domain-like 1.52e-20
Family Pleckstrin-homology domain (PH domain) 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000006989   Gene: ENSMLUG00000007641   Transcript: ENSMLUT00000007655
Sequence length 909
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429895:3278437:3324178:-1 gene:ENSMLUG00000007641 transcript:ENSMLUT00000007655 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEQLSVAEFLAVTVEDLNSPAGAAAFAAKMPRCRGAALVREEMLEGDQAILQRIKKAVR
AIHSSGLGHVENEEHYREAVESLGNSHLSQNSHELSTGFLNLAVFTREVAALFKNLVQNL
NNIVSFPLDSLLKGQLRDGRQDSKKHLEKAWKDYEAKMARLEKERDRARVTGGSHGEVAQ
DTQRERRIFQLHMCEYLLKAGESQMKQGPDFLQSLIKFFHAQHNFFQDGWKAAQSLSPFI
EKLAASVHALRQAQEEELQKLTQLRDSLRGTLQLENREENMSRKNSGGGYSIHQHQGNKQ
FGTEKVGFLYKKNPRIRRVWQKRKCGVKYGCLTISHSMINRPPVKLTLLTCQVRPNPEEK
KCFDLVTHNRTYHFQAEDEHECEAWVSVLQNSKDEALSSAFQGEPSGILGPWGAAGLDGE
LQDLTKLLIAEVKSRPGNGQCCDCGAADPTWLSTNLGVLTCIQCSGVHRELGVRFSRIQS
LTLDLLCPSELLLQLALNIGNTRFNEVMEAQLPSHGGPKPSADSDMSARRDYIVAKYVEH
RFARRSTPEPQRLWMAICNQDLLSVLEAFANGQDFGQLLPGPEGQAPGELALHLAVRVAN
QASLPLVDFIIQNGGHLDAKAADGNSALHYAALYNQPDCLKLLLKGRASVGPVNEEGETA
LDIARKKQHKECEELLEQAKAGTLAFPLHVHYSWGVSTEPGSDSEEDEEEKQHCPLKPPA
QVHWASGRMDISNKTYETITNLGSAAPQSQSEDCPPPLPVKNPSRTTVQGRAGHTSGDHP
EVPSLSSESPGAPESQNSPTSSSSSLTSPVELGGTNQTPPSSEEGLCEPPGTSRPSLTSG
RLSREGGDIGLSLLSSSESTRSYRRGQNLEDCPSATQPPPRRNMLVGFTEGEGSRTGVLP
ASSVLLLQD
Download sequence
Identical sequences G1P9S0
ENSMLUP00000006989 ENSMLUP00000006989

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]