SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007008 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000007008
Domain Number 1 Region: 370-491
Classification Level Classification E-value
Superfamily PH domain-like 2.38e-22
Family Pleckstrin-homology domain (PH domain) 0.000000633
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000007008
Domain Number - Region: 254-354
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00621
Family Synaptotagmin-like (S variant) 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007008   Gene: ENSMLUG00000007649   Transcript: ENSMLUT00000007676
Sequence length 1208
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429822:4016603:4355865:1 gene:ENSMLUG00000007649 transcript:ENSMLUT00000007676 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QISKQQLQTVKDRFQAFLNGETQIVADEAFMNAVQSYYEVFLKSDRVARMVQSGGCSAND
SREVFKKHIEKRVRSLPEIDGLSKETVLSSWMAKFDAIYRGEEDPRKQQARMTASAASEL
ILSKEQLYEMFQNILGIKKFEHQLLYNACQLDNPDEQAAQIRRELDGRLQMADQIARERK
FPKFVSKEMENMYIEELKSSVNLLMANLESMPVSKGGEFKLQKLKRSHNASIIDLGEESE
NQLSKSDVVLAFSLEVVIMEVQGLKSLAPNRIVYCTMEVEGGEKLQTDQAEASKPTWGTQ
GDFSTTHALPAVKVKLFTESTGVLALEDKELGRVILHPTPNSPKQSEWHKMTVSKNCPDQ
DLKIKLAVRMDKPQNMKHSGYLWAIGKNVWKRWKKRFFVLVQVSQYTFAMCSYREKKAEP
QELLQLDGYTVDYTDPQPGLEGGRAFFNAVKEGDTVIFASDDEQDRILWVQAMYRATGQS
HKPVPPTQVQKLNAKGGNVPQLDAPISQFYADRAQKHGMDEFISSNPCNFDHASLFEMVQ
RLTLDHRLNDSYSCLGWFSPGQVFVLDEYCARNGVRGCHRHLCYLRDLLERAENGAMIDP
TLLHYSFAFCASHVHGNRPDGIGTVTVEEKERFEEIKERLRVLLENQITHFRYCFPFGRP
EGALKATLSLLERVLMKDIVTPVPQEEVKTVIRKCLEQAALVNYSRLSEYAKIEENQKDA
ENVGRLITPAKKLEDTIRLAELVIEVLQQNEEHHAEPHVDKGEAFAWWSDLMVEHAETFL
SLFAVDMDAALEVQPPDTWDSFPLFQLLNDFLRTDYNLCNGKFHKHLQDLFAPLVVRYVD
LMESSIAQSIHRGFERESWEPVKSLTSNLPNVNLPNVNLPKVPNLPVNIPLGIPQMPTFS
APSWMAAIYDADNGSGTSEDLFWKLDALQTFIRDLHWPEEEFGKHLEQRLKLMASDMIES
CVKRKTRVPFSENLSSSSRSTDFRVPQSICTMFNVMVDAKAQSTKLCSMEMGQEHQYHSK
IDELIEETVKEMITLLVAKFVTILEGVLAKLSRYDEGTLFSSFLSFTVKAASKYVDVPKP
GMDVADAYVTFVRHSQDVLRDKVNEEMYIERLFDQWYNSSMSVICTWLTDRMDLQLHIYQ
LKTLIRMVKKTYRDFRLQGVLDSTLNSKTYETIRNRLTVEEATASVSEGGGLQGISMKDS
DEEDEEDD
Download sequence
Identical sequences G1P9T5
ENSMLUP00000007008 ENSMLUP00000007008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]