SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007048 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000007048
Domain Number 1 Region: 127-161,211-330
Classification Level Classification E-value
Superfamily ARM repeat 0.000000169
Family Plakophilin 1 helical region 0.05
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000007048
Domain Number - Region: 48-116
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0314
Family FCH domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007048   Gene: ENSMLUG00000007722   Transcript: ENSMLUT00000007719
Sequence length 338
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430449:119904:189564:1 gene:ENSMLUG00000007722 transcript:ENSMLUT00000007719 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TSAAMGEAGGAEEVCGLMGTKEEFVKVRKKDLERLTTEVMQIRDFLPRILNGEVLESFQK
LKVVEKNLERKEQELEQLRMDCEHFKARLETVQADSMKEKKEKLALRQQLNEAKQQLLQQ
AEYCTEMGAAACTLLWGVSSSEEVVKALLGGDKALKFFNITGQTMESFVKSLDGDVKELD
SDENQFVFALAGIVTNVAAIACGREFLVNSSRVLLDTILQLLGDLKPGQCTKLKVLMLMS
LYNVSINLKGLKYISESPGFIPLLWWLLSDPDAEVCLHVLRLVQSVVLEPEVFSKLASEL
RSSLPLQRILAMSKSRNPRLQAVAQELLDDLRALECDA
Download sequence
Identical sequences G1P9W9
ENSMLUP00000007048 ENSMLUP00000007048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]