SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007075 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000007075
Domain Number 1 Region: 872-1145
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.62e-68
Family Protein kinases, catalytic subunit 0.00000797
Further Details:      
 
Domain Number 2 Region: 564-850
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.01e-48
Family Protein kinases, catalytic subunit 0.00016
Further Details:      
 
Domain Number 3 Region: 421-545
Classification Level Classification E-value
Superfamily SH2 domain 2.79e-16
Family SH2 domain 0.0028
Further Details:      
 
Domain Number 4 Region: 147-280
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000000000335
Family Second domain of FERM 0.0041
Further Details:      
 
Domain Number 5 Region: 365-425
Classification Level Classification E-value
Superfamily PH domain-like 0.00000111
Family Third domain of FERM 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007075   Gene: ENSMLUG00000007723   Transcript: ENSMLUT00000007748
Sequence length 1153
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429830:3648812:3701432:-1 gene:ENSMLUG00000007723 transcript:ENSMLUT00000007748 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQYLNIKEDCNAMAFCAKMRSSKKTEVNLEAPEPGVEVLFYLSDREPLRLGSGEYTAEEL
CIRAAQECCISPLCHNLFALYDESTKLWYAPNRSITVDDKTSLRLHYRMRFYFTNWHGTN
DNEQSVWRHSPKKQKNGYEKKKVPDATPLLDASSLEYLFAQGQYDLVKCLAPIRDPKTEQ
DGHDIENECLGMAVLAISHYAMIKKMQLPELPKDISYKRYIPETLNKSIRQRNLLTRMRI
NNVFKDFLKEFNNKTICDSSVSTHDLKVKYLATLETLTKHYGAEIFETSMLLISSENEMN
WLNPNDSGNVLYYEVMVTGNLGIQWRQKPNVVPVEKEKNKLKRKKLENKHKKDEEKNKIR
EEWNNFSYFPEITHIVIKESVVSINKQDNKKMELKLSSHEEALSFVSLVDGYFRLTADAH
HYLCTDVAPPLIVHNIQNGCHGPICTEYAINKLRQEGSEEGMYVLRWSCTDFDNILMTVT
CFEKPEVLGGQKQFKNFQIEVQKGRYSLHGSDRGFPSLGELMSHLKKQILRTDNISFVLK
RCCQPKPREISNLLVATKKAQEWQPVYPMSQLSFDRILKKDIMQGEHLGRGTRTHIYSGT
LMDYKDDEGTSEEKKIKVILKVLDPSHRDISLAFFEAASMMRQVSHKHIVYLYGVCVRDV
ENIMVEEFVEGGPLDLFMHRKSDVLTTPWKFKVAKQLASALSYLEDKDLVHGNVCTKNLL
LAREGIDSECGPFIKLSDPGIPITVLSRQECIERIPWIAPECVEDSKNLSVAADKWSFGT
TLWEICYNGEIPLKDKTLIEKERFYESRCRPVTPSCKELADLMTRCMNYDPNQRPFFRAI
MRDINKLEEQNPDIVSEKQPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNT
GEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLPS
GSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGD
FGLTKAIETDKEYYTVKDDRDSPVFWYAPECLIQCKFYIASDVWSFGVTLHELLTYCDSD
SSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPNNRTT
FQNLIEGFEALLK
Download sequence
Identical sequences G1P9Z2
ENSMLUP00000007075 XP_006089841.1.53796 ENSMLUP00000007075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]