SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007116 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000007116
Domain Number 1 Region: 253-514
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.02e-102
Family Myotubularin-like phosphatases 0.00000084
Further Details:      
 
Domain Number 2 Region: 8-114
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000768
Family VPS36 N-terminal domain-like 0.062
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000007116
Domain Number - Region: 193-255
Classification Level Classification E-value
Superfamily gp120 core 0.0216
Family gp120 core 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007116   Gene: ENSMLUG00000007784   Transcript: ENSMLUT00000007792
Sequence length 561
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429968:315342:369889:1 gene:ENSMLUG00000007784 transcript:ENSMLUT00000007792 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKHIDIERVENVRLLDRISSKKAALGTLYLTATHVIFVENAPDTRKETWILHSQISTIEK
QATTATGCHLLIRCKNFQLLQLIIPQERDCHDVYISLIRLTRPGGYKCVCFPFRLKRNDQ
QFDDAPQSVIRAVLRGEKGGFPLAQLRTVVARGPQVAVRWPEDMPLQTASARPLFVALSG
SCSRFNWPSGGFLWEQAQHACLKLHSSVQCSRDVNPVLSPHLIVNVARESHDTLWRFLSW
VLRVTVLCCRPLQLNAMANRAAGKGYENEDNYSNIKFQFIGIENIHVMRNSLQKMLEVCE
LKSPSMSDFLWGLENSGWLRHIKAIMDAGTFIAKAVAEEGASVLVHCSDGWDRTAQVCSV
ASLLLDPHYRTLKGFMVLIEKDWISFGHKFNHRYGNLDGDPKEISPVIDQFIECVWQLME
QFPCAFEFNERFLIHIQHHIYSCQFGNFLCNSQKERRELKIQERTYSLWAHLWKNRADYM
NPLFRADHSQTQGILRLPTTPCNFMFWSGMYNRFEKGLQPRQSVTDYLMAVKEETQQLEE
ELEALEEVRHTFLTIAAPWKP
Download sequence
Identical sequences G1PA23
ENSMLUP00000007116 ENSMLUP00000007116

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]