SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007124 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000007124
Domain Number 1 Region: 137-164,196-275,306-411
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.41e-46
Family Nuclear receptor ligand-binding domain 0.000000318
Further Details:      
 
Domain Number 2 Region: 85-168
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.43e-31
Family Nuclear receptor 0.0000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007124   Gene: ENSMLUG00000007782   Transcript: ENSMLUT00000007801
Sequence length 411
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430096:1001901:1023791:1 gene:ENSMLUG00000007782 transcript:ENSMLUT00000007801 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGYSTPSPAT
IETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNM
VYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEAPKPECSESYTL
TPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTV
EFAKQLPGFTTLTIADQITLLKAACLDILLCQIVLVSWWWEPETCLGIFLCWVPPPRAGL
SGPLWATTSSAPLLPFKSLYQSTQTPPLPCVASSDRQDLEQPDRVDMLQEPLLEALKVYV
RKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEML
Download sequence
Identical sequences G1PA29
ENSMLUP00000007124 ENSMLUP00000007124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]