SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007129 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000007129
Domain Number 1 Region: 20-105
Classification Level Classification E-value
Superfamily RING/U-box 3.81e-40
Family RING finger domain, C3HC4 0.0000641
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007129   Gene: ENSMLUG00000007815   Transcript: ENSMLUT00000007806
Sequence length 108
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430006:968139:980820:-1 gene:ENSMLUG00000007815 transcript:ENSMLUT00000007806 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ
ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH
Download sequence
Identical sequences A0A0B8RPL5 A0A0D9R0L8 A0A0F7Z435 A0A1S2ZRK6 A0A1S3FVG4 A0A1U7Q7U4 A0A1U7TEP6 A0A1V4JB31 A0A1W7RBW6 A0A226MGL9 A0A226NWN1 A0A250Y906 A0A286XIY3 A0A287B501 A0A2I3GXJ6 A0A2I3NG02 A0A2K5C2T6 A0A2K5HGL9 A0A2K5MKB1 A0A2K5SFZ1 A0A2K6AJM4 A0A2K6D121 A0A2K6F9V1 A0A2K6MYW8 A0A2K6NYT4 B5FY04 E1BSR9 F6PZY6 F7G0U6 F7IAL1 G1NI60 G1PA33 G3VP49 H0XGF8 H2P4I3 H2QLR9 I2CVJ6 I3MPZ6 M3X867 M3YYB6 P62877 P62878 Q2HJI9 Q2PFW7 Q498D8 T1DHM7 U3FAM7
ENSMGAP00000012927 ENSBTAP00000040303 ENSOPRP00000006161 ENSPPYP00000013235 ENSPCAP00000011885 ENSCJAP00000008669 ENSFCAP00000006121 ENSRNOP00000025979 ENSOPRP00000006161 ENSPTRP00000024839 ENSPTRP00000024839 ENSGALP00000019539 gi|7657508|ref|NP_055063.1| ENSMODP00000016335 ENSP00000216225 ENSOGAP00000015164 ENSMLUP00000007129 ENSP00000216225 ENSMUSP00000023036 ENSECAP00000018985 ENSMPUP00000016326 ENSPCAP00000011885 ENSMPUP00000016326 ENSCPOP00000010933 ENSNLEP00000018730 ENSCPOP00000010933 NP_001029307.1.100692 NP_001029307.1.4139 NP_001039706.1.59421 NP_001039706.1.76553 NP_001186179.1.86415 NP_001270023.1.63531 NP_055063.1.87134 NP_055063.1.92137 NP_062686.1.92730 XP_001363807.3.35504 XP_001502369.1.31192 XP_002743847.1.60252 XP_002831227.2.23681 XP_003202340.1.16129 XP_003264846.1.23891 XP_003419866.2.64505 XP_003470429.2.53824 XP_003510352.1.69978 XP_003772281.1.9362 XP_003783217.1.62490 XP_003814667.1.60992 XP_003989336.1.62641 XP_004007058.1.66739 XP_004279567.1.21590 XP_004373950.1.4749 XP_004397485.1.74151 XP_004436508.1.5094 XP_004437954.1.5094 XP_004589534.1.84141 XP_004610591.1.94378 XP_004650394.1.11716 XP_004675695.1.23501 XP_004700330.1.18182 XP_004771323.1.14098 XP_005067069.1.91757 XP_005150381.1.78019 XP_005322275.1.77405 XP_005354216.1.66349 XP_005527707.1.90289 XP_005909488.1.15283 XP_006071327.1.26621 XP_006098598.1.53796 XP_006174771.1.101512 XP_006207179.1.17985 XP_006258609.1.47583 XP_006729981.1.47382 XP_006776037.1.95426 XP_006866940.1.41390 XP_006890153.1.29581 XP_007079501.1.5354 XP_007099982.1.24612 XP_007189167.1.59432 XP_007438091.1.37977 XP_007523473.1.11023 XP_007619879.1.28591 XP_007974079.1.81039 XP_008056320.1.4292 XP_008142804.1.99482 XP_008273399.1.1745 XP_008564912.1.73410 XP_008843039.1.79516 XP_009084781.1.15306 XP_010375845.1.97406 XP_010561395.1.12557 XP_010828429.1.44457 XP_010981829.1.51371 XP_011232812.1.58354 XP_011572843.1.59079 XP_011710530.1.29376 XP_011819548.1.43180 XP_011834184.1.47321 XP_011886693.1.92194 XP_011991839.1.54773 XP_012307328.1.9421 XP_012314470.1.9421 XP_012493606.1.63892 XP_012597221.1.48125 XP_012880365.1.60039 XP_013803537.1.3284 XP_013907556.1.67126 XP_014714477.1.49734 XP_014738163.1.99236 XP_014819825.1.91963 XP_015005936.1.72884 XP_015357365.1.40921 XP_015483009.1.82291 XP_015669082.1.16292 XP_015716271.1.68032 XP_016060804.1.3490 XP_017365852.1.71028 XP_017511288.1.32401 XP_017683120.1.3805 XP_017725765.1.44346 XP_017904299.1.57651 XP_019302534.1.44245 XP_019370674.1.87953 XP_019400539.1.79039 XP_019817426.1.53367 XP_020020067.1.5219 XP_020643582.1.8467 XP_020732539.1.74333 XP_020838349.1.61212 XP_020947123.1.46622 XP_021072686.1.100879 XP_021408413.1.53032 XP_021496004.1.76796 XP_021543109.1.83697 XP_515153.2.37143 XP_531722.2.84170 ENSNLEP00000018730 ENSMGAP00000012927 1u6gB ENSMODP00000016335 ENSSHAP00000004954 ENSSHAP00000004954 ENSOGAP00000015164 ENSMUSP00000023036 10116.ENSRNOP00000025979 10141.ENSCPOP00000010933 9598.ENSPTRP00000024839 9600.ENSPPYP00000013235 9606.ENSP00000216225 9685.ENSFCAP00000006121 9796.ENSECAP00000018985 9913.ENSBTAP00000040303 ENSFCAP00000022819 ENSMICP00000007300 ENSECAP00000018985 ENSBTAP00000040303 ENSMLUP00000007129 ENSSTOP00000013946 Hs7657508___KOG2930 ENSMICP00000007300 ENSPPYP00000013235 ENSRNOP00000025979 1u6g_B 2hye_D ENSP00000216225 ENSSTOP00000013946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]