SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007139 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000007139
Domain Number 1 Region: 243-349
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 0.0000000000115
Family gamma-Butyrobetaine hydroxylase 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007139   Gene: ENSMLUG00000007829   Transcript: ENSMLUT00000007817
Sequence length 366
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430158:502437:511199:-1 gene:ENSMLUG00000007829 transcript:ENSMLUT00000007817 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KVWVPLGTDCLTLLHTHDTNSPKMSLEWLVAWSWSLDGLRDCIATGIQSVRDCDTTAVAT
VACLLVLFVWYCYHVGREQPRPYASVNSLMQGADANGLQNGYVYCQSPECVRCTHNEGLN
QKLYHNLQEYAKRYSWSGMGRIHKGIREQGRYLNSRPSIQKPEVFFLPDLPTTPYFSRDA
QRHDVELLERSFPTILGEFEALYKGFSNCSLPQGWKMNSTPSGEWVTFYLVNQGVCVPRN
CRKCPRTYRLLGSLRTCIGNNVFGNACISVLSPGTVITEHYGPTNIRIRCHLGLKTPSGC
ELVVGGEPQCWAEGRCLLFDDSFLHTAFHEGAAEDGPRVVFMVDLWHPNVAAAERQALDF
IFAPGR
Download sequence
Identical sequences G1PA43
ENSMLUP00000007139 ENSMLUP00000007139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]