SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007197 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000007197
Domain Number 1 Region: 567-655
Classification Level Classification E-value
Superfamily PH domain-like 1.6e-19
Family Third domain of FERM 0.0048
Further Details:      
 
Domain Number 2 Region: 381-474
Classification Level Classification E-value
Superfamily PH domain-like 4.48e-18
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Domain Number 3 Region: 271-324
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000209
Family Second domain of FERM 0.012
Further Details:      
 
Domain Number 4 Region: 531-566
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000419
Family Second domain of FERM 0.0042
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000007197
Domain Number - Region: 26-90
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0126
Family Ubiquitin-related 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007197   Gene: ENSMLUG00000007868   Transcript: ENSMLUT00000007882
Sequence length 678
Comment pep:novel scaffold:Myoluc2.0:GL429945:2680840:2705732:-1 gene:ENSMLUG00000007868 transcript:ENSMLUT00000007882 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSASDFASASWDLVVRVDHPDEEEQKDVTLRVSGDLHVGGVMLKLVEQINIAQDWSDFA
LWWEQKRCWLLKTHWTLDKCGVQADAKLVFTPQHKMLRLRLPNVKTVRLRVSFSAVVFKA
VSDICKALNIRRPEELSLLKPSSDYFKKKKKKDKNNKEPLIEDILNLESSPTISGPPVSP
GLYSKTMTPTYDPVNGTPVSSTMTWFSDSPLTEQNCNILAFSQPPQSPEALADMYQSRSL
VDKTKLNAGWLDSSRSLMEQGIQEDEQLLLRFKYYTFFDLNPKYDAVRINQLYEQARWAI
VLEEIDCTEEEMLIFAALQFHGIHTARSPELLEDCTSESEVDEVEAALSNLEVTLEGGKA
DNTLEDITDIPKLADNLKLFRPKKLILKAFKQYWFVFKDTSITYFKNKELEEGEPVEKLN
LRGCEVVPDVNVAGRKFGIKLLIPVADGMNEVYLRCDHENQYAQWMAACILASKGKTMAD
SSYQPEVLNILSFLRMKNRNSTSSVASGPENMDMNPECFVSPRCAKKHKSKQLAARIMEA
HQNVAQMSLVEAKLRFIQAWQSLPEFGLTYYLVRFKGSKKDDILGVSYNRLIRIDAATGV
PITTWRFANMKQWNVNWEIRQVAIEFDQNVSIAFSCLSADCKVVHEYIGGYIFLSTRSKG
QNETLDEDLFHKLTGGQE
Download sequence
Identical sequences G1PA95
ENSMLUP00000007197 ENSMLUP00000007197

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]