SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007216 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000007216
Domain Number 1 Region: 456-521
Classification Level Classification E-value
Superfamily SH3-domain 3.68e-21
Family SH3-domain 0.001
Further Details:      
 
Domain Number 2 Region: 516-605
Classification Level Classification E-value
Superfamily SH3-domain 2.36e-19
Family SH3-domain 0.00079
Further Details:      
 
Domain Number 3 Region: 683-741
Classification Level Classification E-value
Superfamily SH3-domain 1.02e-18
Family SH3-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007216   Gene: ENSMLUG00000007889   Transcript: ENSMLUT00000007902
Sequence length 742
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430095:424155:448624:1 gene:ENSMLUG00000007889 transcript:ENSMLUT00000007902 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRIPGTGRSSAPPSLESKEEHGRDVAPLGREDRDRGRAEELLAHPQPSDLDPSMQAPPC
SHPAGLSLDDFIPGHLRAHVGSFSRGTRVPVIRNGGSNTLNFQFHDPAPRTVCNGYFPTR
REASRHPDPAWYQTWPGPGSRPAGTQKTPASQQPQNWSATWTKDSKRRDKRWVKYEGIGP
VDESGMPIAPRSSVDSPKDWYRRMFHQIHRKMPDLNLDWTFEEAPKVASSCATSADSRCP
GPQQRPASRPSQASSLSGEGKIHLVNIAIPTRPVALGIINKIEATSQVSTNIINIDLIMT
RASLNEQSFHLVKTCYAPRPAGKGQPMHRGAEPWCTLLPRRWLAGTGHRSPRAAVLALDG
HRPQPKRGWPRPHFPAHPPPRAAAPSPGPASAWSLSNPNALYRGSSWPLSPHRMADGGSP
FLGRRDFVYPASTRDPSGSERGVSPARKEEKKRKAARLKFDFQAQSPKELTLKKGDIVYI
HKEVDKNWLEGEHHGRLGIFPANYVEVLPADEIPKPHKPPTYQVLEYGEAVAQYNFKGDL
EVELSFRKGERICLIRKVNENWYEGRISGTGRQGIFPVSYVQVSREPRLRLCDEGPQLPA
SPSMTAARQAARHPSSPVTPRSPADPTDWGGRTSPRRTGFSFPAQEPKSQTQSLSTPGSS
LSHPGGSSRAVDLGTSSHTTTQINWTPYRAVYQYRPQNEDELELREGDRVDVMQQCDDGW
FVGVSRRTQKFGTFPGNYVAPV
Download sequence
Identical sequences G1PAB2
ENSMLUP00000007216 ENSMLUP00000007216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]